Hepatitis B Surface Antigen preS2 Recombinant Protein (CPRT5526)

(No reviews yet) Write a Review
SKU:
CPRT5526
€278

Description

Data SheetMSDS

HBsAgpreS2 Recombinant Protein

Name:HBsAgpreS2
Synonyms:N/A
Introduction:Hepatitis B virus (HBV) is a human pathogen, causingserious liver disease. The HBV surface protein antigens (HBsAg) are comprised of three carboxyl co terminal HBs proteins termed large (LHBs), middle (MHBs) and small (SHBs, also called major) protein. LHBs and MHBs also share the highly hydrophobic, repetitive, membrane spanningS domain. In addition, MHBs has a 55 amino acid region called preS2.
Description:The Recombinant Hepatitis B Surface Antigen preS2 is approximately 5.7 kDa, a single non–glycosylated polypeptide chain containing 55 amino acids. Purified by proprietary chromatographic technique.
Source:E.coli.
Pack size:50µg
Physical Appearance:N/A
Formulation:HBsAgprotein was lyophilized from 0.2?m filtered (1mg/ml) solution in 20mM PB, pH 7.4 and 50mM NaCl.
Solubility:We recommend that this vial be briefly centrifuged prior to openingto bringthe contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1–1.0 mg/mL. Stock solutions should be apportioned into workingaliquots and stored at <–20°C. Further dilutions should be made in appropriate buffered solutions.
Stability:This lyophilized preparation is stable at 2–8°C, but should be kept at –20°C for longterm storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2–8°C. For maximal stability, apportion the reconstituted preparation into workingaliquots and store at –20°C to –70°C. Avoid repeated freeze/thaw cycles.
Purity:Greater than 95.0% as determined by:(a) Analysis by RP–HPLC.(b) Analysis by SDS–PAGE.
Amino Acid Sequence:MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP ISSIFSRTGDPAPN.
Biological Activity:N/A
Usage:Assay Genie’s products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
View AllClose

Additional Information

Product type:
Recombinant Protein
Reactivity:
Hepatitis B
Host Species:
E.Coli
View AllClose

0 Reviews

View AllClose