Human Spleen Tyrosine Kinase Recombinant Protein (CPRT2657)

(No reviews yet) Write a Review
SKU:
CPRT2657
€278

Description

Recombinant Protein DatasheetAntibody MSDS

SYK Human Recombinant Protein

Name:SYK Human
Synonyms:Tyrosine-protein kinase SYK, Spleen tyrosine kinase, p72-Syk, SYK.
Introduction:Spleen Tyrosine Kinase (SYK) belongs to the family of non–receptor type Tyr protein kinases. The SYK protein is extensively expressed in hematopoietic cells and is involved in couplingactivated immunoreceptors to downstream signalingevents which mediate diverse cellular responses, includingproliferation, differentiation, and phagocytosis. SYK is considered to be a modulator of epithelial cell growth and a likely tumor suppressor in human breast carcinomas. SYK is a positive effector of BCR–stimulated responses. SYK connects the B–cell antigen receptor (BCR) to the utilization of calcium ion either through a phosphoinositide 3–kinase–dependent pathway, when not phosphorylated on tyrosines of the linker region, or through a phospholipase C–gamma–dependent pathway, when phosphorylated on Tyr–348 and Tyr–352. Therefore the differential phosphorylation of Syk can define the pathway by which BCR is coupled to the regulation of intracellular calcium ion (By similarity). SYK also phosphorylates USP25 and regulates its intracellular levels.
Description:SYK Human Recombinant full length protein (1–635 aa) produced in HEK 293 cells with an N–terminal His–Flagtag, having a molecular weight of 74.25kDa.Human SYK is purified by proprietary chromatographic techniques.
Source:HEK 293 cells.
Pack size:10µg
Physical Appearance:Sterile filtered colorless solution.
Formulation:SYK protein is supplied in 50mM Tris pH 7.5, 300mM NaCl and 10% Glycerol.
Solubility:N/A
Stability:Store at 4°C if entire vial will be used within 2–4 weeks.Store, frozen at –20°C for longer periods of time.Please avoid freeze thaw cycles.
Purity:Greater than 85.0% as determined by SDS–PAGE.
Amino Acid Sequence: MHHHHHHDYKDDDDKKLMASSGMADSANHLPFFFGNITREEAEDYLVQGGMSDGL YLLRQSRNYLGGFALSVAHGRKAHHYTIERELNGTYAIAGGRTHASPADLCHYHSQES DGLVCLLKKPFNRPQGVQPKTGPFEDLKENLIREYVKQTWNLQGQALEQAIISQKPQL EKLIATTAHEKMPWFHGKISREESEQIVLIGSKTNGKFLIRARDNNGSYALCLLHEGKV LHYRIDKDKTGKLSIPEGKKFDTLWQLVEHYSYKADGLLRVLTVPCQKIGTQGNVNFgGRPQLPGSHPATWSAGGIISRIKSYSFPKPGHRKSSPAQGNRQESTVSFNPYEPELA PWAADKGPQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDKELGSGNFGTV KKGYYQMKKVVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAES WMLVMEMAELGPLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARN VLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVW SFGVLMWEAFSYGQKPYRGMKGSEVTAMLEKGERMGCPAGCPREMYDLMNLCWT YDVENRPGFAAVELRLRNYYYDVVN.
Biological Activity:N/A
Usage:Assay Genie’s products are furnished for LABORATORY RESEARCH USE ONLY. They may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Uniprot:P43405
View AllClose

Additional Information

Product type:
Recombinant Protein
Reactivity:
Human
Host Species:
HEK 293 cells
View AllClose

0 Reviews

View AllClose