[KO Validated] ADIPOR1 Rabbit Polyclonal Antibody (CAB18045)

(No reviews yet) Write a Review
SKU:
CAB18045
¥17,137.11 - ¥46,363.18

Description

Technical Manual

[KO Validated] ADIPOR1 Rabbit Polyclonal Antibody

Product Name:[KO Validated] ADIPOR1 Rabbit Polyclonal Antibody
Product SKU:CAB18045
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-136 of human ADIPOR1 (NP_057083.2).
Sequence:

MSSHKGSVVAQGNGAPASNREADTVELAELGPLLEEKGKRVIANPPKAEEEQTCPVPQEEEEEVRVLTLPLQAHHAMEKMEEFVYKVWEGRWRVIPYDVLPDWLKDNDYLLHGHRPPMPSFRACFKSIFRIHTETG

Gene ID:51094
Swiss Prot:Q96A54
Synonyms:ADIPOR1; ACDCR1; CGI-45; CGI45; PAQR1; TESBP1A
Calculated MW:42kDa
Observed MW:43kDa
Reactivity:Human, Mouse, Rat
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:293T
Cellular Location:Cell membrane, Multi-pass membrane protein

Product Images

[KO Validated] ADIPOR1 Rabbit Polyclonal Antibody (CAB18045)

Western blot analysis of extracts from normal (control) and ADIPOR1 knockout (KO) 293T cells, using ADIPOR1 antibody (CAB18045) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

Uniprot Information

UniProt Protein Function:ADIPOR1: Receptor for globular and full-length adiponectin (APM1), an essential hormone secreted by adipocytes that acts as an antidiabetic. Probably involved in metabolic pathways that regulate lipid metabolism such as fatty acid oxidation. Mediates increased AMPK, PPARA ligand activity, fatty acid oxidation and glucose uptake by adiponectin. Has some high-affinity receptor for globular adiponectin but low-affinity receptor for full-length adiponectin. Belongs to the ADIPOR family.
UniProt Protein Details:

Protein type:Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q32.1

Cellular Component: membrane; plasma membrane; integral to membrane

Molecular Function:adiponectin binding; identical protein binding; hormone binding; protein heterodimerization activity; receptor activity; protein kinase binding

Biological Process: hormone-mediated signaling; adiponectin-mediated signaling pathway; positive regulation of JAK-STAT cascade; fatty acid oxidation; negative regulation of cell growth; positive regulation of insulin receptor signaling pathway; leptin-mediated signaling pathway

NCBI Summary:This gene encodes a protein which acts as a receptor for adiponectin, a hormone secreted by adipocytes which regulates fatty acid catabolism and glucose levels. Binding of adiponectin to the encoded protein results in activation of an AMP-activated kinase signaling pathway which affects levels of fatty acid oxidation and insulin sensitivity. A pseudogene of this gene is located on chromosome 14. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Mar 2014]
UniProt Code:Q96A54
NCBI GenInfo Identifier:38372248
NCBI Gene ID:51094
NCBI Accession:Q96A54.1
UniProt Secondary Accession:Q96A54,Q53HS7, Q53YY6, Q9Y360, B3KMB0,
UniProt Related Accession:Q96A54
Molecular Weight:375
NCBI Full Name:Adiponectin receptor protein 1
NCBI Synonym Full Names:adiponectin receptor 1
NCBI Official Symbol:ADIPOR1 
NCBI Official Synonym Symbols:CGI45; PAQR1; ACDCR1; CGI-45; TESBP1A 
NCBI Protein Information:adiponectin receptor protein 1; progestin and adipoQ receptor family member I
UniProt Protein Name:Adiponectin receptor protein 1
UniProt Synonym Protein Names:Progestin and adipoQ receptor family member I
Protein Family:Adiponectin receptor protein
UniProt Gene Name:ADIPOR1 
UniProt Entry Name:ADR1_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
View AllClose

0 Reviews

View AllClose