Anti-Beta-Tubulin Antibody (CABC008)

SKU:
CABC008
  • Cell Biology Antibodies 16 Anti-Beta-Tubulin Antibody CABC008
  • Cell Biology Antibodies 16 Anti-Beta-Tubulin Antibody CABC008
  • Cell Biology Antibodies 16 Anti-Beta-Tubulin Antibody CABC008
  • Cell Biology Antibodies 16 Anti-Beta-Tubulin Antibody CABC008
  • Cell Biology Antibodies 16 Anti-Beta-Tubulin Antibody CABC008
€179

Description

Technical Manual

Anti-Beta-Tubulin Antibody

Product Name:Anti-Beta-Tubulin Antibody
Product SKU:CABC008
Size:100 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 40-260 of human Beta-Tubulin (NP_006077.2).
Sequence:

SDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPF

Gene ID:203068
Swiss Prot:P07437
Synonyms:CDCBM6; CSCSC1; M40; OK/SW-cl.56; TUBB1; TUBB5; Beta Tubulin; TUBB; Beta-Tubulin
Calculated MW:50kDa
Observed MW:50kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:5000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence
Positive Samples:SH-SY5Y, MCF7, Mouse testis, Mouse brain, Rat testis
Cellular Location:Cytoplasm, cytoskeleton

Product Images

Anti-Beta-Tubulin Antibody (CABC008)

Western blot analysis of extracts of various cell lines, using beta-Tubulin antibody (CABC008) at 1:10000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.

Anti-Beta-Tubulin Antibody (CABC008)

Immunohistochemistry of paraffin-embedded rat brain using beta-Tubulin Rabbit pAb (CABC008) at dilution of 1:200 (40x lens).

Anti-Beta-Tubulin Antibody (CABC008)

Immunohistochemistry of paraffin-embedded rat kidney using beta-Tubulin Rabbit pAb (CABC008) at dilution of 1:200 (40x lens).

Anti-Beta-Tubulin Antibody (CABC008)

Immunohistochemistry of paraffin-embedded mouse kidney using Beta-Tubulin Rabbit pAb (CABC008) at dilution of 1:200 (40x lens).

Anti-Beta-Tubulin Antibody (CABC008)

Immunofluorescence analysis of C6 cells using Beta-Tubulin Rabbit pAb (CABC008) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:TUBB: Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain. Dimer of alpha and beta chains. May interact with RNABP10. Interacts with PIFO/C1orf88. Ubiquitously expressed with highest levels in spleen, thymus and immature brain. Belongs to the tubulin family.
UniProt Protein Details:

Protein type:Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 6p21.33

Cellular Component: cytoskeleton; extracellular region; microtubule; nuclear envelope lumen; nucleus; protein complex

Molecular Function:GTP binding; GTPase activating protein binding; GTPase activity; MHC class I protein binding; protein binding; protein complex binding; protein domain specific binding; structural constituent of cytoskeleton; structural molecule activity; ubiquitin protein ligase binding

Biological Process: cell division; cell motility; cellular process; cytoskeleton-dependent intracellular transport; G2/M transition of mitotic cell cycle; metabolic process; microtubule-based process; mitotic cell cycle; natural killer cell mediated cytotoxicity; organelle organization and biogenesis; spindle assembly

Disease: Cortical Dysplasia, Complex, With Other Brain Malformations 6

NCBI Summary:This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13. [provided by RefSeq, Jun 2014]
UniProt Code:P07437
NCBI GenInfo Identifier:56757569
NCBI Gene ID:203068
NCBI Accession:P07437.2
UniProt Secondary Accession:P07437,P05218, Q8WUC1, Q9CY33,
UniProt Related Accession:P07437
Molecular Weight:49,671 Da
NCBI Full Name:Tubulin beta chain
NCBI Synonym Full Names:tubulin beta class I
NCBI Official Symbol:TUBB
NCBI Official Synonym Symbols:M40; TUBB1; TUBB5; CDCBM6; CSCSC1; OK/SW-cl.56
NCBI Protein Information:tubulin beta chain
UniProt Protein Name:Tubulin beta chain
UniProt Synonym Protein Names:Tubulin beta-5 chain
Protein Family:Tubulin
UniProt Gene Name:TUBB
UniProt Entry Name:TBB5_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose