CYP2D6 Rabbit Polyclonal Antibody (CAB1299)

(No reviews yet) Write a Review
SKU:
CAB1299
€99 - €249

Description

Technical Manual

CYP2D6 Rabbit Polyclonal Antibody

Product Name:CYP2D6 Rabbit Polyclonal Antibody
Product SKU:CAB1299
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 25% of commonly prescribed drugs. Its substrates include antidepressants, antipsychotics, analgesics and antitussives, beta adrenergic blocking agents, antiarrythmics and antiemetics. The gene is highly polymorphic in the human population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. Some individuals with the poor metabolizer phenotype have no functional protein since they carry 2 null alleles whereas in other individuals the gene is absent. This gene can vary in copy number and individuals with the ultrarapid metabolizer phenotype can have 3 or more active copies of the gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 20-230 of human CYP2D6 (NP_000097.3).
Sequence:

VDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVL

Gene ID:1565
Swiss Prot:P10635
Synonyms:CYP2D6; CPD6; CYP2D; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; CYP2DL1; CYPIID6; P450-DB1; P450C2D; P450DB1
Calculated MW:50kDa/55kDa
Observed MW:60kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC
Recommended Dilution:WB 1:100 - 1:500 IHC 1:20 - 1:100
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry 
Positive Samples:Mouse liver, Rat liver
Cellular Location:Endoplasmic reticulum membrane, Microsome membrane, Peripheral membrane protein

Product Images

CYP2D6 Rabbit Polyclonal Antibody (CAB1299)

Western blot analysis of extracts of various cell lines, using CYP2D6 antibody (CAB1299) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

Uniprot Information

UniProt Protein Function:CYP2D6: Responsible for the metabolism of many drugs and environmental chemicals that it oxidizes. It is involved in the metabolism of drugs such as antiarrhythmics, adrenoceptor antagonists, and tricyclic antidepressants. Belongs to the cytochrome P450 family.
UniProt Protein Details:

Protein type:Oxidoreductase; EC 1.14.14.1; Xenobiotic Metabolism - drug metabolism - cytochrome P450

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: endoplasmic reticulum; endoplasmic reticulum membrane; mitochondrion

Molecular Function:arachidonic acid epoxygenase activity; drug binding; heme binding; iron ion binding; monooxygenase activity; oxidoreductase activity; steroid hydroxylase activity

Biological Process: alkaloid catabolic process; alkaloid metabolic process; arachidonic acid metabolic process; coumarin metabolic process; drug catabolic process; drug metabolic process; heterocycle metabolic process; isoquinoline alkaloid metabolic process; monoterpenoid metabolic process; negative regulation of binding; steroid metabolic process; xenobiotic metabolic process

Disease: Drug Metabolism, Poor, Cyp2d6-related

NCBI Summary:This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and is known to metabolize as many as 25% of commonly prescribed drugs. Its substrates include antidepressants, antipsychotics, analgesics and antitussives, beta adrenergic blocking agents, antiarrythmics and antiemetics. The gene is highly polymorphic in the human population; certain alleles result in the poor metabolizer phenotype, characterized by a decreased ability to metabolize the enzyme's substrates. Some individuals with the poor metabolizer phenotype have no functional protein since they carry 2 null alleles whereas in other individuals the gene is absent. This gene can vary in copy number and individuals with the ultrarapid metabolizer phenotype can have 3 or more active copies of the gene. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
UniProt Code:P10635
NCBI GenInfo Identifier:84028191
NCBI Gene ID:1565
NCBI Accession:P10635.2
UniProt Secondary Accession:P10635,Q16752, Q2XND6, Q2XND7, Q2XNE0, Q6B012, Q6NXU8
UniProt Related Accession:P10635
Molecular Weight:50,061 Da
NCBI Full Name:Cytochrome P450 2D6
NCBI Synonym Full Names:cytochrome P450 family 2 subfamily D member 6
NCBI Official Symbol:CYP2D6 
NCBI Official Synonym Symbols:CPD6; CYP2D; CYP2DL1; CYPIID6; P450C2D; P450DB1; CYP2D7AP; CYP2D7BP; CYP2D7P2; CYP2D8P2; P450-DB1 
NCBI Protein Information:cytochrome P450 2D6
UniProt Protein Name:Cytochrome P450 2D6
UniProt Synonym Protein Names:CYPIID6; Cholesterol 25-hydroxylase
Protein Family:Cytochrome
UniProt Gene Name:CYP2D6 
UniProt Entry Name:CP2D6_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose