Anti-FABP5 Antibody (CAB18087)[KO Validated]

SKU:
CAB18087
€129 - €349

Description

Technical Manual

Anti-FABP5 Antibody [KO Validated]

Product Name:Anti-FABP5 Antibody [KO Validated]
Product SKU:CAB18087
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human FABP5 (NP_001435.1).
Sequence:

MATVQQLEGRWRLVDSKGFDEYMKELGVGIALRKMGAMAKPDCIITCDGKNLTIKTESTLKTTQFSCTLGEKFEETTADGRKTQTVCNFTDGALVQHQEWDGKESTITRKLKDGKLVVECVMNNVTCTRIYEKVE

Gene ID:2171
Swiss Prot:Q01469
Synonyms:FABP5; E-FABP; EFABP; KFABP; PA-FABP; PAFABP
Calculated MW:15kDa
Observed MW:15kDa
Reactivity:Human, Mouse
Application:WB IF
Recommended Dilution:WB 1:500 - 1:2000 IF 1:50 - 1:100
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunofluorescence 
Positive Samples:HeLa
Cellular Location:Cytoplasm

Product Images

Anti-FABP5 Antibody [KO Validated] (CAB18087)

Western blot analysis of extracts from normal (control) and FABP5 knockout (KO) HeLa cells, using FABP5 antibody (CAB18087) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.

Uniprot Information

UniProt Protein Function:FABP5: High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.
UniProt Protein Details:

Protein type:Lipid-binding

Chromosomal Location of Human Ortholog: 8q21.13

Cellular Component: nucleoplasm; cytoplasm; cytosol

Molecular Function:protein binding; transporter activity; fatty acid binding; lipid binding

Biological Process: epidermis development; phosphatidylcholine biosynthetic process; glucose metabolic process; lipid metabolic process; glucose transport

NCBI Summary:This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABPs may play roles in fatty acid uptake, transport, and metabolism. Polymorphisms in this gene are associated with type 2 diabetes. The human genome contains many pseudogenes similar to this locus.[provided by RefSeq, Feb 2011]
UniProt Code:Q01469
NCBI GenInfo Identifier:232081
NCBI Gene ID:2171
NCBI Accession:Q01469.3
UniProt Secondary Accession:Q01469,B2R4K0,
UniProt Related Accession:Q01469
Molecular Weight:15,164 Da
NCBI Full Name:Fatty acid-binding protein, epidermal
NCBI Synonym Full Names:fatty acid binding protein 5 (psoriasis-associated)
NCBI Official Symbol:FABP5 
NCBI Official Synonym Symbols:EFABP; KFABP; E-FABP; PAFABP; PA-FABP 
NCBI Protein Information:fatty acid-binding protein, epidermal; epidermal-type fatty acid-binding protein; psoriasis-associated fatty acid-binding protein homolog
UniProt Protein Name:Fatty acid-binding protein, epidermal
UniProt Synonym Protein Names:Epidermal-type fatty acid-binding protein; E-FABP; Fatty acid-binding protein 5; Psoriasis-associated fatty acid-binding protein homolog
Protein Family:Fatty acid-binding protein
UniProt Gene Name:FABP5 
UniProt Entry Name:FABP5_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Host Species:
Rabbit
Isotype:
IgG
Research Area:
Signal Transduction
View AllClose