[KO Validated] RB Rabbit Polyclonal Antibody (CAB0003)

(No reviews yet) Write a Review
SKU:
CAB0003
  • Western blot analysis of extracts of various cell lines, using RB antibody (CAB0003) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.
  • Western blot analysis of extracts from normal (control) and RB Rabbit pAb knockout (KO) HeLa cells, using RB Rabbit pAb antibody (CAB0003) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.
  • Immunofluorescence analysis of Y79 cells using Rb Polyclonal Antibody (CAB0003) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
€99 - €249

Description

Technical Manual

[KO Validated] RB Rabbit Polyclonal Antibody

Product Name:[KO Validated] RB Rabbit Polyclonal Antibody
Product SKU:CAB0003
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 701-928 of human RB (NP_000312.2).
Sequence:

DQIMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRVLIKEEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTLSPIPHIPRSPYKFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFGTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQKQKMNDSMDTSNKEEK

Gene ID:5925
Swiss Prot:P06400
Synonyms:OSRC; PPP1R130; RB; p105-Rb; pRb; pp110; RB1; Rb
Calculated MW:106kDa
Observed MW:110kDa
Reactivity:Human
Application:WB IF
Recommended Dilution:WB 1:500 - 1:2000 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunofluorescence 
Positive Samples:HeLa, A-431
Cellular Location:Nucleus

Product Images

[KO Validated] RB Rabbit Polyclonal Antibody (CAB0003)

Western blot analysis of extracts of various cell lines, using RB antibody (CAB0003) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

[KO Validated] RB Rabbit Polyclonal Antibody (CAB0003)

Western blot analysis of extracts from normal (control) and RB Rabbit pAb knockout (KO) HeLa cells, using RB Rabbit pAb antibody (CAB0003) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

[KO Validated] RB Rabbit Polyclonal Antibody (CAB0003)

Immunofluorescence analysis of Y79 cells using Rb Polyclonal Antibody (CAB0003) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:Rb: retinoblastoma tumor suppressor protein regulates cell proliferation by controlling progression through the G1-phase restriction point. Has three distinct binding domains and interacts with regulatory proteins including the E2F family of transcription factors, c-Abl tyrosine kinase and proteins with a conserved LXCXE motif. Cell cycle-dependent phosphorylation by Cdks inhibits Rb target binding, thus allowing cell cycle progression. Recruits and targets histone methyltransferase suv39h1 leading to epigenetic transcriptional repression.
UniProt Protein Details:

Protein type:Oncoprotein; Transcription, coactivator/corepressor; Nuclear receptor co-regulator; Tumor suppressor

Chromosomal Location of Human Ortholog: 13q14.2

Cellular Component: nucleoplasm; SWI/SNF complex; PML body; Rb-E2F complex; spindle; chromatin; nucleus

Molecular Function:identical protein binding; protein binding; androgen receptor binding; DNA binding; ubiquitin protein ligase binding; transcription coactivator activity; phosphoprotein binding; transcription factor binding; kinase binding; transcription factor activity

Biological Process: sister chromatid biorientation; viral reproduction; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter, mitotic; regulation of mitotic cell cycle; neuron maturation; positive regulation of macrophage differentiation; cell cycle arrest; neurite development; negative regulation of epithelial cell proliferation; transcription, DNA-dependent; negative regulation of transcription factor activity; mitotic cell cycle checkpoint; enucleate erythrocyte differentiation; regulation of lipid kinase activity; chromatin remodeling; G1/S-specific transcription in mitotic cell cycle; myoblast differentiation; neuron apoptosis; maintenance of mitotic sister chromatid cohesion; gut development; cell division; neuron morphogenesis during differentiation; negative regulation of smoothened signaling pathway; androgen receptor signaling pathway; Ras protein signal transduction; positive regulation of mitotic metaphase/anaphase transition; negative regulation of protein kinase activity; striated muscle cell differentiation; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; negative regulation of transcription, DNA-dependent; cell cycle checkpoint; G1/S transition of mitotic cell cycle

Disease: Bladder Cancer; Osteogenic Sarcoma; Small Cell Cancer Of The Lung; Retinoblastoma

NCBI Summary:The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophosphorylated form of the protein binds transcription factor E2F1. Defects in this gene are a cause of childhood cancer retinoblastoma (RB), bladder cancer, and osteogenic sarcoma. [provided by RefSeq, Jul 2008]
UniProt Code:P06400
NCBI GenInfo Identifier:132164
NCBI Gene ID:5925
NCBI Accession:P06400.2
UniProt Secondary Accession:P06400,P78499, Q5VW46, Q8IZL4, A8K5E3,
UniProt Related Accession:P06400
Molecular Weight:928
NCBI Full Name:Retinoblastoma-associated protein
NCBI Synonym Full Names:retinoblastoma 1
NCBI Official Symbol:RB1 
NCBI Official Synonym Symbols:RB; pRb; OSRC; pp110; p105-Rb; PPP1R130 
NCBI Protein Information:retinoblastoma-associated protein; retinoblastoma suspectibility protein; prepro-retinoblastoma-associated protein; protein phosphatase 1, regulatory subunit 130
UniProt Protein Name:Retinoblastoma-associated protein
UniProt Synonym Protein Names:p105-Rb; pRb; Rb; pp110
Protein Family:Retinoblastoma-associated protein
UniProt Gene Name:RB1 
UniProt Entry Name:RB_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose