ADSS Rabbit Polyclonal Antibody (CAB12398)

(No reviews yet) Write a Review
SKU:
CAB12398
  • Western blot analysis of extracts of various cell lines, using ADSS Antibody (CAB12398) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.
  • Immunohistochemistry of paraffin-embedded human lung cancer using ADSS antibody (CAB12398) at dilution of 1:100 (40x lens).
  • Immunohistochemistry of paraffin-embedded human colon using ADSS antibody (CAB12398) at dilution of 1:100 (40x lens).
  • Immunohistochemistry of paraffin-embedded human esophageal cancer using ADSS antibody (CAB12398) at dilution of 1:100 (40x lens).
  • Immunohistochemistry of paraffin-embedded mouse brain using ADSS antibody (CAB12398) at dilution of 1:100 (40x lens).
€99 - €249

Description

Technical Manual

ADSS Rabbit Polyclonal Antibody

Product Name:ADSS Rabbit Polyclonal Antibody
Product SKU:CAB12398
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes the enzyme adenylosuccinate synthetase which catalyzes the first committed step in the conversion of inosine monophosphate to adenosine monophosphate. A pseudogene of this gene is found on chromosome 17.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ADSS (NP_001117.2).
Sequence:

MAFAETYPAASSLPNGDCGRPRARPGGNRVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGLEGWEKRLIISDRAHIVFDFHQAADGIQEQQRQEQAGKNLGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQYKSIYPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVC

Gene ID:159
Swiss Prot:P30520
Synonyms:ADSS; ADEH; ADSS 2; ADSS2
Calculated MW:50kDa
Observed MW:50kDa
Reactivity:Human, Mouse
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence 
Positive Samples:293T, Mouse lung, Mouse brain
Cellular Location:Cytoplasm

Product Images

ADSS Rabbit Polyclonal Antibody (CAB12398)

Western blot analysis of extracts of various cell lines, using ADSS Antibody (CAB12398) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

ADSS Rabbit Polyclonal Antibody (CAB12398)

Immunohistochemistry of paraffin-embedded human lung cancer using ADSS antibody (CAB12398) at dilution of 1:100 (40x lens).

ADSS Rabbit Polyclonal Antibody (CAB12398)

Immunohistochemistry of paraffin-embedded human colon using ADSS antibody (CAB12398) at dilution of 1:100 (40x lens).

ADSS Rabbit Polyclonal Antibody (CAB12398)

Immunohistochemistry of paraffin-embedded human esophageal cancer using ADSS antibody (CAB12398) at dilution of 1:100 (40x lens).

ADSS Rabbit Polyclonal Antibody (CAB12398)

Immunohistochemistry of paraffin-embedded mouse brain using ADSS antibody (CAB12398) at dilution of 1:100 (40x lens).

Uniprot Information

UniProt Protein Function:ADSS: Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. Belongs to the adenylosuccinate synthetase family.
UniProt Protein Details:

Protein type:EC 6.3.4.4; Nucleotide Metabolism - purine; Ligase; Amino Acid Metabolism - alanine, aspartate and glutamate

Chromosomal Location of Human Ortholog: 1q44

Cellular Component: cytoplasm; plasma membrane; cytosol

Molecular Function:protein binding; GTP binding; magnesium ion binding; phosphate binding; adenylosuccinate synthase activity

Biological Process: AMP biosynthetic process; response to purine; purine ribonucleoside monophosphate biosynthetic process; nucleobase, nucleoside and nucleotide metabolic process; immune system process; IMP metabolic process; aspartate metabolic process; purine base metabolic process

NCBI Summary:This gene encodes the enzyme adenylosuccinate synthetase which catalyzes the first committed step in the conversion of inosine monophosphate to adenosine monophosphate. A pseudogene of this gene is found on chromosome 17.[provided by RefSeq, Nov 2010]
UniProt Code:P30520
NCBI GenInfo Identifier:21264498
NCBI Gene ID:159
NCBI Accession:P30520.3
UniProt Secondary Accession:P30520,Q96EG7, B1AQM5,
UniProt Related Accession:P30520
Molecular Weight:456
NCBI Full Name:Adenylosuccinate synthetase isozyme 2
NCBI Synonym Full Names:adenylosuccinate synthase
NCBI Official Symbol:ADSS 
NCBI Official Synonym Symbols:ADEH; ADSS 2 
NCBI Protein Information:adenylosuccinate synthetase isozyme 2; adSS 2; AMPSase 2; IMP--aspartate ligase 2; L-type adenylosuccinate synthetase; adenylosuccinate synthetase, liver isozyme; adenylosuccinate synthetase, acidic isozyme; adenylosuccinate synthetase (Ade(-)H-complementing)
UniProt Protein Name:Adenylosuccinate synthetase isozyme 2
UniProt Synonym Protein Names:Adenylosuccinate synthetase, acidic isozyme; Adenylosuccinate synthetase, liver isozyme; IMP--aspartate ligase 2
Protein Family:Adenylosuccinate synthetase
UniProt Gene Name:ADSS 
UniProt Entry Name:PURA2_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose