Anti-CAPN9 Antibody (CAB17085)

SKU:
CAB17085
€99 - €249

Description

Technical Manual

Anti-CAPN9 Antibody

Product Name:Anti-CAPN9 Antibody
Product SKU:CAB17085
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is expressed predominantly in stomach and small intestine and may have specialized functions in the digestive tract. This gene is thought to be associated with gastric cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 391-690 of human CAPN9 (NP_006606.1).
Sequence:

QEECSFLVALMQKDRRKLKRFGANVLTIGYAIYECPDKDEHLNKDFFRYHASRARSKTFINLREVSDRFKLPPGEYILIPSTFEPHQEADFCLRIFSEKKAITRDMDGNVDIDLPEPPKPTPPDQETEEEQRFRALFEQVAGEDMEVTAEELEYVLNAVLQKKKDIKFKKLSLISCKNIISLMDTSGNGKLEFDEFKVFWDKLKQWINLFLRFDADKSGTMSTYELRTALKAAGFQLSSHLLQLIVLRYADEELQLDFDDFLNCLVRLENASRVFQALSTKNKEFIHLNINEFIHLTMNI

Gene ID:10753
Swiss Prot:O14815
Synonyms:CAPN9; GC36; nCL-4; calpain-9
Calculated MW:76kDa/79kDa
Observed MW:Refer to figures
Reactivity:Human, Mouse, Rat
Application:WB IHC
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry
Positive Samples:
Cellular Location:

Product Images

Anti-CAPN9 Antibody (CAB17085)

Immunohistochemistry - CAPN9 Polyclonal Antibody (CAB17085)

Uniprot Information

UniProt Protein Function:CAPN9: Calcium-regulated non-lysosomal thiol-protease. Belongs to the peptidase C2 family. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Calcium-binding; EC 3.4.22.-; Protease

Chromosomal Location of Human Ortholog: 1q42.11-q42.3

Cellular Component: cytoplasm

NCBI Summary:Calpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. The protein encoded by this gene is expressed predominantly in stomach and small intestine and may have specialized functions in the digestive tract. This gene is thought to be associated with gastric cancer. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
UniProt Code:O14815
NCBI GenInfo Identifier:32129432
NCBI Gene ID:10753
NCBI Accession:O14815.1
UniProt Secondary Accession:O14815,Q9NS74, B1APS1, B1AQI0,
UniProt Related Accession:O14815
Molecular Weight:76,168 Da
NCBI Full Name:Calpain-9
NCBI Synonym Full Names:calpain 9
NCBI Official Symbol:CAPN9
NCBI Official Synonym Symbols:GC36; nCL-4
NCBI Protein Information:calpain-9
UniProt Protein Name:Calpain-9
UniProt Synonym Protein Names:Digestive tract-specific calpain; New calpain 4; nCL-4; Protein CG36
Protein Family:Calpain
UniProt Gene Name:CAPN9
UniProt Entry Name:CAN9_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Signal Transduction
View AllClose