Anti-GFAP Antibody (CAB14673)

SKU:
CAB14673
  • Cell Biology Antibodies 5 Anti-GFAP Antibody CAB14673
  • Cell Biology Antibodies 5 Anti-GFAP Antibody CAB14673
  • Cell Biology Antibodies 5 Anti-GFAP Antibody CAB14673
  • Cell Biology Antibodies 5 Anti-GFAP Antibody CAB14673
  • Cell Biology Antibodies 5 Anti-GFAP Antibody CAB14673
€99 - €249

Description

Technical Manual

Anti-GFAP Antibody

Product Name:Anti-GFAP Antibody
Product SKU:CAB14673
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human GFAP (NP_002046.1).
Sequence:

RGTNESLERQMREQEERHVREAASYQEALARLEEEGQSLKDEMARHLQEYQDLLNVKLALDIEIATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKESKQEHKDVM

Gene ID:2670
Swiss Prot:P14136
Synonyms:ALXDRD; GFAP
Calculated MW:49kDa/50kDa
Observed MW:50kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence
Positive Samples:mouse brain, rat brain
Cellular Location:Cytoplasm

Product Images

Anti-GFAP Antibody (CAB14673)

Western blot analysis of extracts of various cell lines, using GFAP antibody (CAB14673) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

Anti-GFAP Antibody (CAB14673)

Immunohistochemistry of paraffin-embedded rat brain using GFAP antibody (CAB14673) at dilution of 1:200 (40x lens).

Anti-GFAP Antibody (CAB14673)

Immunohistochemistry of paraffin-embedded rat cerebellum using GFAP antibody (CAB14673) at dilution of 1:100 (40x lens).

Anti-GFAP Antibody (CAB14673)

Immunohistochemistry of paraffin-embedded mouse brain using GFAP antibody (CAB14673) at dilution of 1:100 (40x lens).

Anti-GFAP Antibody (CAB14673)

Immunofluorescence analysis of U-251 MG cells using GFAP Rabbit pAb (CAB14673) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:GFAP: a class-III intermediate filament protein. A cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. An additional transcript variant isoform has been described, but its full length sequence has not been determined.
UniProt Protein Details:

Protein type:Cytoskeletal

Chromosomal Location of Human Ortholog: 17q21

Cellular Component: membrane; cytoplasm; intermediate filament; cytosol

Molecular Function:integrin binding; structural constituent of cytoskeleton; kinase binding

Biological Process: Bergmann glial cell differentiation; extracellular matrix organization and biogenesis; regulation of neurotransmitter uptake; response to wounding; intermediate filament organization; neurite regeneration; astrocyte development

Disease: Alexander Disease

NCBI Summary:This gene encodes one of the major intermediate filament proteins of mature astrocytes. It is used as a marker to distinguish astrocytes from other glial cells during development. Mutations in this gene cause Alexander disease, a rare disorder of astrocytes in the central nervous system. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Oct 2008]
UniProt Code:P14136
NCBI GenInfo Identifier:121135
NCBI Gene ID:2670
NCBI Accession:P14136.1
UniProt Secondary Accession:P14136,Q53H98, Q5D055, Q6ZQS3, Q7Z5J6, Q7Z5J7, Q96KS4 Q96P18, Q9UFD0, B2RD44, D3DX59, E9PAX3,
UniProt Related Accession:P14136
Molecular Weight:432
NCBI Full Name:Glial fibrillary acidic protein
NCBI Synonym Full Names:glial fibrillary acidic protein
NCBI Official Symbol:GFAP
NCBI Protein Information:glial fibrillary acidic protein
UniProt Protein Name:Glial fibrillary acidic protein
Protein Family:Glial fibrillary acidic protein
UniProt Gene Name:GFAP
UniProt Entry Name:GFAP_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose