Anti-EEF1B2 Antibody (CAB6580)[KO Validated]

SKU:
CAB6580
  • KO Validated Antibodies 1 Anti-EEF1B2 Antibody CAB6580KO Validated
  • KO Validated Antibodies 1 Anti-EEF1B2 Antibody CAB6580KO Validated
  • KO Validated Antibodies 1 Anti-EEF1B2 Antibody CAB6580KO Validated
  • KO Validated Antibodies 1 Anti-EEF1B2 Antibody CAB6580KO Validated
  • KO Validated Antibodies 1 Anti-EEF1B2 Antibody CAB6580KO Validated
€129 - €349

Description

Technical Manual

Anti-EEF1B2 Antibody [KO Validated]

Product Name:Anti-EEF1B2 Antibody [KO Validated]
Product SKU:CAB6580
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human EEF1B2 (NP_001032752.1).
Sequence:

MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLPGVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKSSILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAFEDYVQSMDVAAFNKI

Gene ID:1933
Swiss Prot:P24534
Synonyms:EEF1B2; EEF1B; EEF1B1; EF1B
Calculated MW:24kDa
Observed MW:33kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence
Positive Samples:MCF-7, HL-60, HeLa, 293T, Mouse pancreas
Cellular Location:

Product Images

Anti-EEF1B2 Antibody [KO Validated] (CAB6580)

Western blot analysis of extracts of various cell lines, using EEF1B2 antibody (CAB6580) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

Anti-EEF1B2 Antibody [KO Validated] (CAB6580)

Western blot analysis of extracts from normal (control) and EEF1B2 knockout (KO) 293T cells, using EEF1B2 antibody (CAB6580) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.

Anti-EEF1B2 Antibody [KO Validated] (CAB6580)

Immunohistochemistry of paraffin-embedded rat spinal cord using EEF1B2 Antibody (CAB6580) at dilution of 1:100 (40x lens).

Anti-EEF1B2 Antibody [KO Validated] (CAB6580)

Immunohistochemistry of paraffin-embedded rat brain using EEF1B2 Antibody (CAB6580) at dilution of 1:100 (40x lens).

Anti-EEF1B2 Antibody [KO Validated] (CAB6580)

Immunohistochemistry of paraffin-embedded mouse brain using EEF1B2 Antibody (CAB6580) at dilution of 1:100 (40x lens).

Uniprot Information

UniProt Protein Function:EF-1-beta and EF-1-delta stimulate the exchange of GDP bound to EF-1-alpha to GTP.
NCBI Summary:This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq, Jul 2008]
UniProt Code:P24534
NCBI GenInfo Identifier:119163
NCBI Gene ID:1933
NCBI Accession:P24534.3
UniProt Secondary Accession:P24534,Q6IBH9, A8K795,
UniProt Related Accession:P24534
Molecular Weight:24,764 Da
NCBI Full Name:Elongation factor 1-beta
NCBI Synonym Full Names:eukaryotic translation elongation factor 1 beta 2
NCBI Official Symbol:EEF1B2
NCBI Official Synonym Symbols:EF1B; EEF1B; EEF1B1
NCBI Protein Information:elongation factor 1-beta
UniProt Protein Name:Elongation factor 1-beta
UniProt Gene Name:EEF1B2
UniProt Entry Name:EF1B_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Metabolism
View AllClose