Anti-NCSTN Antibody (CAB17111)

SKU:
CAB17111
€99 - €249

Description

Technical Manual

Anti-NCSTN Antibody

Product Name:Anti-NCSTN Antibody
Product SKU:CAB17111
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a type I transmembrane glycoprotein that is an integral component of the multimeric gamma-secretase complex. The encoded protein cleaves integral membrane proteins, including Notch receptors and beta-amyloid precursor protein, and may be a stabilizing cofactor required for gamma-secretase complex assembly. The cleavage of beta-amyloid precursor protein yields amyloid beta peptide, the main component of the neuritic plaque and the hallmark lesion in the brains of patients with Alzheimer's disease; however, the nature of the encoded protein's role in Alzheimer's disease is not known for certain. Mutations in this gene are associated with familial acne inversa. A pseudogene of this gene is present on chromosome 21. Alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 429-669 of human NCSTN (NP_056146.1).
Sequence:

RFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFVTDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQDLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLYEYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARIFLIASKELE

Gene ID:23385
Swiss Prot:Q92542
Synonyms:NCSTN; ATAG1874; nicastrin
Calculated MW:76kDa/78kDa
Observed MW:100kDa
Reactivity:Human, Mouse
Application:WB IHC
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry
Positive Samples:Mouse spleen
Cellular Location:Melanosome, Membrane, Single-pass type I membrane protein

Product Images

Anti-NCSTN Antibody (CAB17111)

Western blot - NCSTN Rabbit pAb (CAB17111)

Uniprot Information

UniProt Protein Function:nicastrin: Essential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral membrane proteins such as Notch receptors and APP (beta- amyloid precursor protein). It probably represents a stabilizing cofactor required for the assembly of the gamma-secretase complex. Component of the gamma-secretase complex, a complex composed of a presenilin homodimer (PSEN1 or PSEN2), nicastrin (NCSTN), APH1 (APH1A or APH1B) and PEN2. Such minimal complex is sufficient for secretase activity, although other components may exist. Binds to proteolytic processed C-terminal fragments C83 and C99 of the amyloid precursor protein (APP). Constitutively expressed in neural cells. Widely expressed. Belongs to the nicastrin family. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q22-q23

Cellular Component: Golgi apparatus; focal adhesion; membrane; lysosomal membrane; integral to plasma membrane; endoplasmic reticulum; melanosome; plasma membrane; integral to membrane

Molecular Function:protein binding; endopeptidase activity

Biological Process: positive regulation of catalytic activity; axon guidance; extracellular matrix organization and biogenesis; Notch signaling pathway; membrane protein intracellular domain proteolysis; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; membrane protein ectodomain proteolysis; myeloid cell homeostasis; Notch receptor processing; proteolysis; T cell proliferation; extracellular matrix disassembly; epithelial cell proliferation; amyloid precursor protein catabolic process; beta-amyloid metabolic process; ephrin receptor signaling pathway; protein processing

Disease: Acne Inversa, Familial, 1

NCBI Summary:This gene encodes a type I transmembrane glycoprotein that is an integral component of the multimeric gamma-secretase complex. The encoded protein cleaves integral membrane proteins, including Notch receptors and beta-amyloid precursor protein, and may be a stabilizing cofactor required for gamma-secretase complex assembly. The cleavage of beta-amyloid precursor protein yields amyloid beta peptide, the main component of the neuritic plaque and the hallmark lesion in the brains of patients with Alzheimer's disease; however, the nature of the encoded protein's role in Alzheimer's disease is not known for certain. Mutations in this gene are associated with familial acne inversa. A pseudogene of this gene is present on chromosome 21. Alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Feb 2014]
UniProt Code:Q92542
NCBI GenInfo Identifier:12231037
NCBI Gene ID:23385
NCBI Accession:Q92542.2
UniProt Secondary Accession:Q92542,Q5T207, Q5T208, Q86VV5,
UniProt Related Accession:Q92542
Molecular Weight:709
NCBI Full Name:Nicastrin
NCBI Synonym Full Names:nicastrin
NCBI Official Symbol:NCSTN
NCBI Official Synonym Symbols:ATAG1874
NCBI Protein Information:nicastrin; anterior pharynx-defective 2
UniProt Protein Name:Nicastrin
Protein Family:Nicastrin
UniProt Gene Name:NCSTN
UniProt Entry Name:NICA_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Signal Transduction
View AllClose