PRKAG1 Rabbit Polyclonal Antibody (CAB7300)

(No reviews yet) Write a Review
SKU:
CAB7300
  • Western blot analysis of extracts of various cell lines, using PRKAG1 antibody (CAB7300) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution._Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 60s.
  • Immunohistochemistry of paraffin-embedded human stomach using PRKAG1 antibody (CAB7300) at dilution of 1:100 (40x lens).
  • Immunohistochemistry of paraffin-embedded rat brain using PRKAG1 antibody (CAB7300) at dilution of 1:100 (40x lens).
  • Immunohistochemistry of paraffin-embedded mouse kidney using PRKAG1 antibody (CAB7300) at dilution of 1:100 (40x lens).
  • Immunofluorescence analysis of MCF-7 cells using PRKAG1 antibody (CAB7300). Blue: DAPI for nuclear staining.
€99 - €249

Description

Technical Manual

PRKAG1 Rabbit Polyclonal Antibody

Product Name:PRKAG1 Rabbit Polyclonal Antibody
Product SKU:CAB7300
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit is one of the gamma regulatory subunits of AMPK. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-331 of human PRKAG1 (NP_002724.1).
Sequence:

METVISSDSSPAVENEHPQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP

Gene ID:5571
Swiss Prot:P54619
Synonyms:PRKAG1; AMPKG
Calculated MW:34kDa/37kDa/38kDa
Observed MW:36kDa/38kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence 
Positive Samples:Jurkat, 22Rv1, Mouse kidney, Mouse thymus
Cellular Location:

Product Images

PRKAG1 Rabbit Polyclonal Antibody (CAB7300)

Western blot analysis of extracts of various cell lines, using PRKAG1 antibody (CAB7300) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution._Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 60s.

PRKAG1 Rabbit Polyclonal Antibody (CAB7300)

Immunohistochemistry of paraffin-embedded human stomach using PRKAG1 antibody (CAB7300) at dilution of 1:100 (40x lens).

PRKAG1 Rabbit Polyclonal Antibody (CAB7300)

Immunohistochemistry of paraffin-embedded rat brain using PRKAG1 antibody (CAB7300) at dilution of 1:100 (40x lens).

PRKAG1 Rabbit Polyclonal Antibody (CAB7300)

Immunohistochemistry of paraffin-embedded mouse kidney using PRKAG1 antibody (CAB7300) at dilution of 1:100 (40x lens).

PRKAG1 Rabbit Polyclonal Antibody (CAB7300)

Immunofluorescence analysis of MCF-7 cells using PRKAG1 antibody (CAB7300). Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:AMPKG1: a non-catalytic subunit of AMPK, a highly conserved kinase of the CAMKL family. The holoenzyme consists of a catalytic subunit (alpha) and two regulatory subunits (beta, gamma). Each subunit exists as multiple genetic isoforms giving rise to 12 different possible combinations of holoenzyme. Plays a key role in regulation of energy homeostasis. Activated by an elevated AMP-ATP ratio due to environmental stress, such as heat shock, hypoxia and ischemia. AMPK phosphorylates and regulates many metabolic enzymes.
UniProt Protein Details:

Protein type:Autophagy; Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 12q12-q14

Cellular Component: AMP-activated protein kinase complex; cytosol; membrane; nucleoplasm

Molecular Function:ADP binding; AMP binding; AMP-activated protein kinase activity; ATP binding; cAMP-dependent protein kinase activity; cAMP-dependent protein kinase regulator activity; protein binding; protein kinase activity; protein kinase binding

Biological Process: cell cycle arrest; macroautophagy; positive regulation of protein kinase activity; protein amino acid phosphorylation; regulation of glycolysis; signal transduction; spermatogenesis

NCBI Summary:The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit is one of the gamma regulatory subunits of AMPK. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]
UniProt Code:P54619
NCBI GenInfo Identifier:1703037
NCBI Gene ID:5571
NCBI Accession:P54619.1
UniProt Secondary Accession:P54619,Q8N7V9, B4DDT7,
UniProt Related Accession:P54619
Molecular Weight:38,533 Da
NCBI Full Name:5'-AMP-activated protein kinase subunit gamma-1
NCBI Synonym Full Names:protein kinase AMP-activated non-catalytic subunit gamma 1
NCBI Official Symbol:PRKAG1 
NCBI Official Synonym Symbols:AMPKG 
NCBI Protein Information:5'-AMP-activated protein kinase subunit gamma-1
UniProt Protein Name:5'-AMP-activated protein kinase subunit gamma-1
Protein Family:5'-AMP-activated protein kinase
UniProt Gene Name:PRKAG1 
UniProt Entry Name:AAKG1_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose