PROK2 Rabbit Polyclonal Antibody (CAB6705)

(No reviews yet) Write a Review
SKU:
CAB6705
  • Western blot analysis of extracts of various cell lines, using PROK2 antibody (CAB6705) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.
  • Immunohistochemistry of paraffin-embedded mouse brain using PROK2 antibody (CAB6705) at dilution of 1:100 (40x lens).
€99 - €249

Description

Technical Manual

PROK2 Rabbit Polyclonal Antibody

Product Name:PROK2 Rabbit Polyclonal Antibody
Product SKU:CAB6705
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a protein expressed in the suprachiasmatic nucleus (SCN) circadian clock that may function as the output component of the circadian clock. The secreted form of the encoded protein may also serve as a chemoattractant for neuronal precursor cells in the olfactory bulb. Proteins from other vertebrates which are similar to this gene product were isolated based on homology to snake venom and secretions from frog skin, and have been shown to have diverse functions. Mutations in this gene are associated with Kallmann syndrome 4. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 20-129 of human PROK2 (NP_001119600.1).
Sequence:

LTPRAGDAAVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKNNFGNGRQERRKRKRSKRKKEVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK

Gene ID:60675
Swiss Prot:Q9HC23
Synonyms:PROK2; BV8; HH4; KAL4; MIT1; PK2
Calculated MW:11kDa/14kDa
Observed MW:17kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence 
Positive Samples:HT-29, HL-60, HepG2, Mouse liver, Rat thymus
Cellular Location:Secreted

Product Images

PROK2 Rabbit Polyclonal Antibody (CAB6705)

Western blot analysis of extracts of various cell lines, using PROK2 antibody (CAB6705) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.

PROK2 Rabbit Polyclonal Antibody (CAB6705)

Immunohistochemistry of paraffin-embedded mouse brain using PROK2 antibody (CAB6705) at dilution of 1:100 (40x lens).

Uniprot Information

UniProt Protein Function:PROK2: May function as an output molecule from the suprachiasmatic nucleus (SCN) that transmits behavioral circadian rhythm. May also function locally within the SCN to synchronize output. Potently contracts gastrointestinal (GI) smooth muscle. Defects in PROK2 are the cause of Kallmann syndrome type 4 (KAL4); also known as hypogonadotropic hypogonadism and anosmia. Anosmia or hyposmia is related to the absence or hypoplasia of the olfactory bulbs and tracts. Hypogonadism is due to deficiency in gonadotropin-releasing hormone and probably results from a failure of embryonic migration of gonadotropin- releasing hormone-synthesizing neurons. KAL4 patients have variable degrees of olfactory and reproductive dysfunction, but do not show any of the occasional clinical anomalies reported in Kallmann syndrome such as renal agenesis, cleft lip/palate, selective tooth agenesis, and bimanual synkinesis. Belongs to the AVIT (prokineticin) family. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 3p13

Cellular Component: extracellular region

Molecular Function:G-protein-coupled receptor binding

Biological Process: circadian rhythm; activation of MAPK activity; sensory perception of pain; chemotaxis; cell proliferation; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; neuropeptide signaling pathway; spermatogenesis; angiogenesis; positive regulation of smooth muscle contraction; inflammatory response; negative regulation of apoptosis

Disease: Hypogonadotropic Hypogonadism 4 With Or Without Anosmia

NCBI Summary:This gene encodes a protein expressed in the suprachiasmatic nucleus (SCN) circadian clock that may function as the output component of the circadian clock. The secreted form of the encoded protein may also serve as a chemoattractant for neuronal precursor cells in the olfactory bulb. Proteins from other vertebrates which are similar to this gene product were isolated based on homology to snake venom and secretions from frog skin, and have been shown to have diverse functions. Mutations in this gene are associated with Kallmann syndrome 4. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
UniProt Code:Q9HC23
NCBI GenInfo Identifier:18202953
NCBI Gene ID:60675
NCBI Accession:Q9HC23.2
UniProt Secondary Accession:Q9HC23,Q53Z79, Q6ISR0,
UniProt Related Accession:Q9HC23
Molecular Weight:Calculated MW: 11kDa/14kDaObserved MW: 17kDa
NCBI Full Name:Prokineticin-2
NCBI Synonym Full Names:prokineticin 2
NCBI Official Symbol:PROK2 
NCBI Official Synonym Symbols:BV8; HH4; PK2; KAL4; MIT1 
NCBI Protein Information:prokineticin-2; protein Bv8 homolog
UniProt Protein Name:Prokineticin-2
UniProt Synonym Protein Names:Protein Bv8 homolog
Protein Family:Prokineticin
UniProt Gene Name:PROK2 
UniProt Entry Name:PROK2_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose