PRL Rabbit Polyclonal Antibody (CAB1618)

(No reviews yet) Write a Review
SKU:
CAB1618
  • Western blot analysis of extracts of various cell lines, using PRL antibody (CAB1618) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.
  • Immunofluorescence analysis of HeLa cells using PRL antibody (CAB1618).
€99 - €249

Description

Technical Manual

PRL Rabbit Polyclonal Antibody

Product Name:PRL Rabbit Polyclonal Antibody
Product SKU:CAB1618
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 29-227 of human PRL (NP_001157030.1).
Sequence:

LPICPGGAARCQVTLRDLFDRAVVLSHYIHNLSSEMFSEFDKRYTHGRGFITKAINSCHTSSLATPEDKEQAQQMNQKDFLSLIVSILRSWNEPLYHLVTEVRGMQEAPEAILSKAVEIEEQTKRLLEGMELIVSQVHPETKENEIYPVWSGLPSLQMADEESRLSAYYNLLHCLRRDSHKIDNYLKLLKCRIIHNNNC

Gene ID:5617
Swiss Prot:P01236
Synonyms:PRL; GHA1; prolactin
Calculated MW:25kDa
Observed MW:30kDa
Reactivity:Human, Mouse, Rat
Application:WB IF
Recommended Dilution:WB 1:500 - 1:2000 IF 1:10 - 1:100
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunofluorescence 
Positive Samples:U-937, PC-3, Mouse brain, Rat brain
Cellular Location:Secreted

Product Images

PRL Rabbit Polyclonal Antibody (CAB1618)

Western blot analysis of extracts of various cell lines, using PRL antibody (CAB1618) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.

PRL Rabbit Polyclonal Antibody (CAB1618)

Immunofluorescence analysis of HeLa cells using PRL antibody (CAB1618).

Uniprot Information

UniProt Protein Function:prolactin: Prolactin acts primarily on the mammary gland by promoting lactation. Belongs to the somatotropin/prolactin family.
UniProt Protein Details:

Protein type:Secreted, signal peptide; Secreted; Cytokine; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: extracellular region

Molecular Function:protein binding; prolactin receptor binding; hormone activity

Biological Process: lactation; cell proliferation; cell surface receptor linked signal transduction; regulation of multicellular organism growth; positive regulation of JAK-STAT cascade; female pregnancy

NCBI Summary:This gene encodes the anterior pituitary hormone prolactin. This secreted hormone is a growth regulator for many tissues, including cells of the immune system. It may also play a role in cell survival by suppressing apoptosis, and it is essential for lactation. Alternative splicing results in multiple transcript variants that encode the same protein. [provided by RefSeq, Aug 2011]
UniProt Code:P01236
NCBI GenInfo Identifier:130930
NCBI Gene ID:5617
NCBI Accession:P01236.1
UniProt Secondary Accession:P01236,Q15199, Q92996,
UniProt Related Accession:P01236
Molecular Weight:25,876 Da
NCBI Full Name:Prolactin
NCBI Synonym Full Names:prolactin
NCBI Official Symbol:PRL 
NCBI Protein Information:prolactin; decidual prolactin
UniProt Protein Name:Prolactin
UniProt Gene Name:PRL 
UniProt Entry Name:PRL_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose