Anti-DIAPH3 Antibody (CAB10351)

SKU:
CAB10351
€99 - €249

Description

Technical Manual

Anti-DIAPH3 Antibody

Product Name:Anti-DIAPH3 Antibody
Product SKU:CAB10351
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the diaphanous subfamily of the formin family. Members of this family are involved in actin remodeling and regulate cell movement and adhesion. Mutations in this gene are associated with autosomal dominant auditory neuropathy 1. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 630-849 of human DIAPH3 (NP_112194.2).
Sequence:

KYPDILNFVDDLEPLDKASKVSVETLEKNLRQMGRQLQQLEKELETFPPPEDLHDKFVTKMSRFVISAKEQYETLSKLHENMEKLYQSIIGYYAIDVKKVSVEDFLTDLNNFRTTFMQAIKENIKKREAEEKEKRVRIAKELAERERLERQQKKKRLLEMKTEGDETGVMDNLLEALQSGAAFRDRRKRTPMPKDVRQSLSPMSQRPVLKVCNHGNKPYL

Gene ID:81624
Swiss Prot:Q9NSV4
Synonyms:DIAPH3; AN; AUNA1; DIA2; DRF3; NSDAN; diap3; mDia2
Calculated MW:79kDa/98kDa/127-136kDa
Observed MW:137kDa
Reactivity:Human
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:MCF7, HeLa, HT-1080, NCI-H460
Cellular Location:Cytoplasm, cytosol

Product Images

Anti-DIAPH3 Antibody (CAB10351)

Western blot analysis of extracts of various cell lines, using DIAPH3 antibody (CAB10351) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

Uniprot Information

UniProt Protein Function:Diaphanous-3: Binds to GTP-bound form of Rho and to profilin. Acts in a Rho-dependent manner to recruit profilin to the membrane, where it promotes actin polymerization. It is required for cytokinesis, stress fiber formation, and transcriptional activation of the serum response factor. DFR proteins couple Rho and Src tyrosine kinase during signaling and the regulation of actin dynamics. Defects in DIAPH3 are the cause of auditory neuropathy, autosomal dominant, type 1 (AUNA1). A form of sensorineural hearing loss with absent or severely abnormal auditory brainstem response, in the presence of normal cochlear outer hair cell function and normal otoacoustic emissions. Auditory neuropathies result from a lesion in the area including the inner hair cells, connections between the inner hair cells and the cochlear branch of the auditory nerve, the auditory nerve itself and auditory pathways of the brainstem. A disease- causing mutation in the conserved 5'-UTR leads to increased protein expression (PubMed:20624953). Belongs to the formin homology family. Diaphanous subfamily. 7 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 13q21.2

Cellular Component: cytosol; nucleus

Molecular Function:Rho GTPase binding; actin binding

Biological Process: spermatogenesis; actin cytoskeleton organization and biogenesis

Disease: Auditory Neuropathy, Autosomal Dominant, 1

NCBI Summary:This gene encodes a member of the diaphanous subfamily of the formin family. Members of this family are involved in actin remodeling and regulate cell movement and adhesion. Mutations in this gene are associated with autosomal dominant auditory neuropathy 1. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]
UniProt Code:Q9NSV4
NCBI GenInfo Identifier:158520000
NCBI Gene ID:81624
NCBI Accession:Q9NSV4.4
UniProt Related Accession:Q9NSV4
Molecular Weight:
NCBI Full Name:Protein diaphanous homolog 3
NCBI Synonym Full Names:diaphanous related formin 3
NCBI Official Symbol:DIAPH3 
NCBI Official Synonym Symbols:AN; DIA2; DRF3; AUNA1; NSDAN; diap3; mDia2 
NCBI Protein Information:protein diaphanous homolog 3
UniProt Protein Name:Protein diaphanous homolog 3
UniProt Synonym Protein Names:Diaphanous-related formin-3; DRF3; MDia2
Protein Family:Protein diaphanous
UniProt Gene Name:DIAPH3 
UniProt Entry Name:DIAP3_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose