Anti-ERAL1 Antibody (CAB10382)

SKU:
CAB10382
€99 - €249

Description

Technical Manual

Anti-ERAL1 Antibody

Product Name:Anti-ERAL1 Antibody
Product SKU:CAB10382
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

The protein encoded by this gene is a GTPase that localizes to the mitochondrion. The encoded protein binds to the 3' terminal stem loop of 12S mitochondrial rRNA and is required for proper assembly of the 28S small mitochondrial ribosomal subunit. Deletion of this gene has been shown to cause mitochondrial dysfunction, growth retardation, and apoptosis. Several transcript variants encoding different isoforms have been found for this gene.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 198-437 of human ERAL1 (NP_005693.1).
Sequence:

DLVVVLVDVSDKWTRNQLSPQLLRCLTKYSQIPSVLVMNKVDCLKQKSVLLELTAALTEGVVNGKKLKMRQAFHSHPGTHCPSPAVKDPNTQSVGNPQRIGWPHFKEIFMLSALSQEDVKTLKQYLLTQAQPGPWEYHSAVLTSQTPEEICANIIREKLLEHLPQEVPYNVQQKTAVWEEGPGGELVIQQKLLVPKESYVKLLIGPKGHVISQIAQEAGHDLMDIFLCDVDIRLSVKLLK

Gene ID:26284
Swiss Prot:O75616
Synonyms:ERAL1; CEGA; ERA; ERA-W; ERAL1A; H-ERA; HERA-A; HERA-B; GTPase Era
Calculated MW:30kDa/48kDa
Observed MW:48KDa
Reactivity:Human, Mouse, Rat
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting
Positive Samples:HeLa, 293T
Cellular Location:Mitochondrion inner membrane, Mitochondrion matrix, Peripheral membrane protein

Product Images

Anti-ERAL1 Antibody (CAB10382)

Western blot analysis of extracts of various cell lines, using ERAL1 Rabbit pAb (CAB10382) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.

Uniprot Information

UniProt Protein Function:ERAL1: Probable GTPase that plays a role in the mitochondrial ribosomal small subunit assembly. Specifically binds the 12S mitochondrial rRNA (12S mt-rRNA) to a 33 nucleotide section delineating the 3' terminal stem-loop region. May act as a chaperone that protects the 12S mt-rRNA on the 28S mitoribosomal subunit during ribosomal small subunit assembly. Belongs to the Era/MnmE GTP-binding protein family. Era subfamily. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Mitochondrial

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: actin cytoskeleton; cytoplasm; intermediate filament cytoskeleton; mitochondrial matrix; mitochondrion

Molecular Function:protein binding; ribosomal small subunit binding; rRNA binding

Biological Process: ribosomal small subunit assembly and maintenance

NCBI Summary:The protein encoded by this gene is a GTPase that localizes to the mitochondrion. The encoded protein binds to the 3' terminal stem loop of 12S mitochondrial rRNA and is required for proper assembly of the 28S small mitochondrial ribosomal subunit. Deletion of this gene has been shown to cause mitochondrial dysfunction, growth retardation, and apoptosis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]
UniProt Code:O75616
NCBI GenInfo Identifier:57015286
NCBI Gene ID:26284
NCBI Accession:O75616.2
UniProt Secondary Accession:O75616,O75617, Q8WUY4, Q96LE2, Q96TC0, B3KN21, C9JEC6
UniProt Related Accession:O75616
Molecular Weight:30,040 Da
NCBI Full Name:GTPase Era, mitochondrial
NCBI Synonym Full Names:Era like 12S mitochondrial rRNA chaperone 1
NCBI Official Symbol:ERAL1
NCBI Official Synonym Symbols:ERA; CEGA; ERA-W; H-ERA; ERAL1A; HERA-A; HERA-B
NCBI Protein Information:GTPase Era, mitochondrial
UniProt Protein Name:GTPase Era, mitochondrial
UniProt Synonym Protein Names:Conserved ERA-like GTPase; CEGA; ERA-W; ERA-like protein 1
UniProt Gene Name:ERAL1
UniProt Entry Name:ERAL1_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose