Fatty Acid Synthase Rabbit Polyclonal Antibody (CAB0461)

(No reviews yet) Write a Review
SKU:
CAB0461
  • Western blot analysis of extracts of various cell lines, using Fatty Acid Synthase antibody (CAB0461) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.
  • Immunohistochemistry of paraffin-embedded human breast cancer using Fatty Acid Synthase antibody (CAB0461) at dilution of 1:200 (40x lens).
  • Immunofluorescence analysis of A549 cells using Fatty Acid Synthase antibody (CAB0461). Blue: DAPI for nuclear staining.
  • Immunoprecipitation analysis of 200ug extracts of 293T cells, using 3 ug Fatty Acid Synthase antibody (CAB0461). Western blot was performed from the immunoprecipitate using Fatty Acid Synthase antibody (CAB0461) at a dilition of 1:1000.
€99 - €249

Description

Technical Manual

Fatty Acid Synthase Rabbit Polyclonal Antibody

Product Name:Fatty Acid Synthase Rabbit Polyclonal Antibody
Product SKU:CAB0461
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 2212-2511 of human Fatty Acid Synthase (NP_004095.4).
Sequence:

QQQTQLNLRSLLVNPEGPTLMRLNSVQSSERPLFLVHPIEGSTTVFHSLASRLSIPTYGLQCTRAAPLDSIHSLAAYYIDCIRQVQPEGPYRVAGYSYGACVAFEMCSQLQAQQSPAPTHNSLFLFDGSPTYVLAYTQSYRAKLTPGCEAEAETEAICFFVQQFTDMEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGGAYGEDLGADYNLSQVCDGKVSVHVIEGDHRTLLEGSGLESIISIIHSSLAEPRVSVREG

Gene ID:2194
Swiss Prot:P49327
Synonyms:FAS; OA-519; SDR27X1; FASN
Calculated MW:273kDa
Observed MW:273kDa
Reactivity:Human, Mouse
Application:WB IHC IF IP
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:100
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation 
Positive Samples:Mouse liver, Mouse lung
Cellular Location:Cytoplasm, Melanosome

Product Images

Fatty Acid Synthase Rabbit Polyclonal Antibody (CAB0461)

Western blot analysis of extracts of various cell lines, using Fatty Acid Synthase antibody (CAB0461) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.

Fatty Acid Synthase Rabbit Polyclonal Antibody (CAB0461)

Immunohistochemistry of paraffin-embedded human breast cancer using Fatty Acid Synthase antibody (CAB0461) at dilution of 1:200 (40x lens).

Fatty Acid Synthase Rabbit Polyclonal Antibody (CAB0461)

Immunofluorescence analysis of A549 cells using Fatty Acid Synthase antibody (CAB0461). Blue: DAPI for nuclear staining.

Fatty Acid Synthase Rabbit Polyclonal Antibody (CAB0461)

Immunoprecipitation analysis of 200ug extracts of 293T cells, using 3 ug Fatty Acid Synthase antibody (CAB0461). Western blot was performed from the immunoprecipitate using Fatty Acid Synthase antibody (CAB0461) at a dilition of 1:1000.

Uniprot Information

UniProt Protein Function:FASN: a multifunctional enzyme. Catalyzes the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.
UniProt Protein Details:

Protein type:EC 1.3.1.39; EC 1.1.1.100; EC 2.3.1.39; EC 3.1.2.14; Hydrolase; EC 2.3.1.41; EC 4.2.1.59; Oxidoreductase; EC 2.3.1.38; Lyase; EC 2.3.1.85; Lipid Metabolism - fatty acid biosynthesis; Acetyltransferase

Chromosomal Location of Human Ortholog: 17q25

Cellular Component: Golgi apparatus; membrane; glycogen granule; mitochondrion; cytoplasm; plasma membrane; melanosome; cytosol

Molecular Function:fatty-acid synthase activity; protein homodimerization activity; myristoyl-[acyl-carrier-protein] hydrolase activity; 3-oxoacyl-[acyl-carrier-protein] synthase activity; zinc ion binding; enoyl-[acyl-carrier-protein] reductase (NADPH, A-specific) activity; enoyl-[acyl-carrier-protein] reductase (NADPH, B-specific) activity; drug binding; [acyl-carrier-protein] S-acetyltransferase activity; 3-oxoacyl-[acyl-carrier-protein] reductase activity; protein binding; 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity; oleoyl-[acyl-carrier-protein] hydrolase activity; palmitoyl-[acyl-carrier-protein] hydrolase activity; [acyl-carrier-protein] S-malonyltransferase activity; 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase activity

Biological Process: osteoblast differentiation; vitamin metabolic process; acetyl-CoA metabolic process; pantothenate metabolic process; energy reserve metabolic process; positive regulation of cellular metabolic process; triacylglycerol biosynthetic process; cellular lipid metabolic process; fatty acid metabolic process; fatty acid biosynthetic process; water-soluble vitamin metabolic process

NCBI Summary:The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha. [provided by RefSeq, Jul 2008]
UniProt Code:P49327
NCBI GenInfo Identifier:269849686
NCBI Gene ID:2194
NCBI Accession:P49327.3
UniProt Secondary Accession:P49327,Q13479, Q16702, Q4LE83, Q6P4U5, Q6SS02, Q969R1 Q96C68, Q96IT0,
UniProt Related Accession:P49327
Molecular Weight:2511
NCBI Full Name:Fatty acid synthase
NCBI Synonym Full Names:fatty acid synthase
NCBI Official Symbol:FASN 
NCBI Official Synonym Symbols:FAS; OA-519; SDR27X1 
NCBI Protein Information:fatty acid synthase; short chain dehydrogenase/reductase family 27X, member 1
UniProt Protein Name:Fatty acid synthase
Protein Family:Fatty acid synthase
UniProt Gene Name:FASN 
UniProt Entry Name:FAS_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose