Anti-FCRL3 Antibody (CAB10451)

SKU:
CAB10451
€99 - €249

Description

Technical Manual

Anti-FCRL3 Antibody

Product Name:Anti-FCRL3 Antibody
Product SKU:CAB10451
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain and may play a role in regulation of the immune system. Mutations in this gene have been associated with rheumatoid arthritis, autoimmune thyroid disease, and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 600-720 of human FCRL3 (NP_443171.2).
Sequence:

RRKPGGLSATGTSSHSPSECQEPSSSRPSRIDPQEPTHSKPLAPMELEPMYSNVNPGDSNPIYSQIWSIQHTKENSANCPMMHQEHEELTVLYSELKKTHPDDSAGEASSRGRAHEEDDEE

Gene ID:115352
Swiss Prot:Q96P31
Synonyms:FCRL3; CD307c; FCRH3; IFGP3; IRTA3; SPAP2
Calculated MW:21kDa/22kDa/69kDa/77kDa/80kDa/81kDa
Observed MW:105kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:100 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry
Positive Samples:Raji, B cells, 293T, U-937, Mouse kidney, Rat kidney
Cellular Location:Cell membrane, Single-pass type I membrane protein

Product Images

Anti-FCRL3 Antibody (CAB10451)

Western blot analysis of extracts of various cell lines, using FCRL3 antibody (CAB10451) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s.

Uniprot Information

UniProt Protein Function:FCRL3: Genetic variation in FCRL3 may be a cause of susceptibility to rheumatoid arthritis (RA). It is a systemic inflammatory disease with autoimmune features and a complex genetic component. It primarily affects the joints and is characterized by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures. Genetic variation in FCRL3 may influence susceptibility to autoimmune disorders, including Graves disease. Graves disease is an autoimmune disorder associated with overactivity of the thyroid gland and hyperthyroidism. 7 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Adaptor/scaffold; Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q23.1

NCBI Summary:This gene encodes a member of the immunoglobulin receptor superfamily and is one of several Fc receptor-like glycoproteins clustered on the long arm of chromosome 1. The encoded protein contains immunoreceptor-tyrosine activation motifs and immunoreceptor-tyrosine inhibitory motifs in its cytoplasmic domain and may play a role in regulation of the immune system. Mutations in this gene have been associated with rheumatoid arthritis, autoimmune thyroid disease, and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
UniProt Code:Q96P31
NCBI GenInfo Identifier:74761021
NCBI Gene ID:115352
NCBI Accession:Q96P31.1
UniProt Secondary Accession:Q96P31,Q5VXZ8, Q8N6S2, Q96LA4, Q96P27, Q96P28, Q96P29 Q96P30, A0N0M4, A8MTH7, D3DVD2,
UniProt Related Accession:Q96P31
Molecular Weight:81kDa
NCBI Full Name:Fc receptor-like protein 3
NCBI Synonym Full Names:Fc receptor like 3
NCBI Official Symbol:FCRL3
NCBI Official Synonym Symbols:FCRH3; IFGP3; IRTA3; SPAP2; CD307c
NCBI Protein Information:Fc receptor-like protein 3
UniProt Protein Name:Fc receptor-like protein 3
UniProt Synonym Protein Names:Fc receptor homolog 3; FcRH3; IFGP family protein 3; hIFGP3; Immune receptor translocation-associated protein 3; SH2 domain-containing phosphatase anchor protein 2; CD_antigen: CD307c
Protein Family:Fc receptor-like protein
UniProt Gene Name:FCRL3
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose