Anti-FGF21 Antibody (CAB10368)

SKU:
CAB10368
€99 - €249

Description

Technical Manual

Anti-FGF21 Antibody

Product Name:Anti-FGF21 Antibody
Product SKU:CAB10368
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

Theis gene encodes a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes. This protein is a secreted endocrine factor that functions as a major metabolic regulator. The encoded protein stimulates the uptake of glucose in adipose tissue.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 29-209 of human FGF21 (NP_061986.1).
Sequence:

HPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS

Gene ID:26291
Swiss Prot:Q9NSA1
Synonyms:FGF21
Calculated MW:22kDa
Observed MW:16kDa
Reactivity:Human, Mouse
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:LO2, Mouse pancreas
Cellular Location:Secreted

Product Images

Anti-FGF21 Antibody (CAB10368)

Western blot analysis of extracts of various cell lines, using FGF21 antibody (CAB10368) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

Uniprot Information

UniProt Protein Function:FGF21: Stimulates glucose uptake in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression (but not SLC2A4/GLUT4 expression). Activity requires the presence of KLB. Belongs to the heparin-binding growth factors family.
UniProt Protein Details:

Protein type:Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: extracellular region

Molecular Function:protein binding; growth factor activity; fibroblast growth factor receptor binding

Biological Process: positive regulation of glucose import; cell-cell signaling; positive regulation of cell proliferation; positive regulation of low-density lipoprotein receptor biosynthetic process; signal transduction

NCBI Summary:The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The function of this growth factor has not yet been determined. [provided by RefSeq, Jul 2008]
UniProt Code:Q9NSA1
NCBI GenInfo Identifier:13626703
NCBI Gene ID:26291
NCBI Accession:Q9NSA1.1
UniProt Secondary Accession:Q9NSA1,Q8N683,
UniProt Related Accession:Q9NSA1
Molecular Weight:22,300 Da
NCBI Full Name:Fibroblast growth factor 21
NCBI Synonym Full Names:fibroblast growth factor 21
NCBI Official Symbol:FGF21 
NCBI Protein Information:fibroblast growth factor 21
UniProt Protein Name:Fibroblast growth factor 21
Protein Family:Fibroblast growth factor
UniProt Gene Name:FGF21 
UniProt Entry Name:FGF21_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose