INHA Rabbit Polyclonal Antibody (CAB1734)

(No reviews yet) Write a Review
SKU:
CAB1734
  • Western blot analysis of extracts of rat testis, using INHA antibody (CAB1734) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
  • Immunohistochemistry of paraffin-embedded rat brain using INHA antibody (CAB1734) at dilution of 1:200 (40x lens).
€99 - €249

Description

Technical Manual

INHA Rabbit Polyclonal Antibody

Product Name:INHA Rabbit Polyclonal Antibody
Product SKU:CAB1734
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate multiple peptide products, including the alpha subunit of the inhibin A and B protein complexes. These complexes negatively regulate follicle stimulating hormone secretion from the pituitary gland. Inhibins have also been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. Mutations in this gene may be associated with male infertility and premature ovarian failure in female human patients.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 19-366 of human INHA (NP_002182.1).
Sequence:

CQGLELARELVLAKVRALFLDALGPPAVTREGGDPGVRRLPRRHALGGFTHRGSEPEEEEDVSQAILFPATDASCEDKSAARGLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEPLLGLLALSPGGPVAVPMSLGHAPPHWAVLHLATSALSLLTHPVLVLLLRCPLCTCSARPEATPFLVAHTRTRPPSGGERARRSTPLMSWPWSPSALRLLQRPPEEPAAHANCHRVALNISFQELGWERWIVYPPSFIFHYCHGGCGLHIPPNLSLPVPGAPPTPAQPYSLLPGAQPCCAALPGTMRPLHVRTTSDGGYSFKYETVPNLLTQHCACI

Gene ID:3623
Swiss Prot:P05111
Synonyms:INHA
Calculated MW:39kDa
Observed MW:40kDa
Reactivity:Mouse, Rat
Application:WB IHC
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry 
Positive Samples:Rat testis
Cellular Location:Secreted

Product Images

INHA Rabbit Polyclonal Antibody (CAB1734)

Western blot analysis of extracts of rat testis, using INHA antibody (CAB1734) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

INHA Rabbit Polyclonal Antibody (CAB1734)

Immunohistochemistry of paraffin-embedded rat brain using INHA antibody (CAB1734) at dilution of 1:200 (40x lens).

Uniprot Information

UniProt Protein Function:INHA: Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins. Belongs to the TGF-beta family.
UniProt Protein Details:

Protein type:Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: extracellular region

Molecular Function:cytokine activity; growth factor activity; hormone activity; protein binding; receptor binding; transforming growth factor beta receptor binding

Biological Process: cell cycle arrest; cell development; cell differentiation; cell surface receptor linked signal transduction; cell-cell signaling; hemoglobin biosynthetic process; negative regulation of B cell differentiation; negative regulation of cell cycle; negative regulation of interferon-gamma biosynthetic process; negative regulation of macrophage differentiation; negative regulation of phosphorylation; positive regulation of follicle-stimulating hormone secretion; regulation of apoptosis; regulation of cell cycle; regulation of cell proliferation; regulation of MAPKKK cascade; response to external stimulus; signal transduction; skeletal development

NCBI Summary:This gene encodes a member of the TGF-beta (transforming growth factor-beta) superfamily of proteins. The encoded preproprotein is proteolytically processed to generate multiple peptide products, including the alpha subunit of the inhibin A and B protein complexes. These complexes negatively regulate follicle stimulating hormone secretion from the pituitary gland. Inhibins have also been implicated in regulating numerous cellular processes including cell proliferation, apoptosis, immune response and hormone secretion. Mutations in this gene may be associated with male infertility and premature ovarian failure in female human patients. [provided by RefSeq, Aug 2016]
UniProt Code:P05111
NCBI GenInfo Identifier:124274
NCBI Gene ID:3623
NCBI Accession:P05111.1
UniProt Secondary Accession:P05111,A8K8H5,
UniProt Related Accession:P05111
Molecular Weight:39,670 Da
NCBI Full Name:Inhibin alpha chain
NCBI Synonym Full Names:inhibin alpha subunit
NCBI Official Symbol:INHA 
NCBI Protein Information:inhibin alpha chain
UniProt Protein Name:Inhibin alpha chain
Protein Family:Inhibin
UniProt Gene Name:INHA 
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose