Anti-NF2 Antibody (CAB0739)[KO Validated]

SKU:
CAB0739
  • KO Validated Antibodies 1 Anti-NF2 Antibody CAB0739KO Validated
  • KO Validated Antibodies 1 Anti-NF2 Antibody CAB0739KO Validated
  • KO Validated Antibodies 1 Anti-NF2 Antibody CAB0739KO Validated
  • KO Validated Antibodies 1 Anti-NF2 Antibody CAB0739KO Validated
  • KO Validated Antibodies 1 Anti-NF2 Antibody CAB0739KO Validated
€129 - €349

Description

Technical Manual

Anti-NF2 Antibody [KO Validated]

Product Name:Anti-NF2 Antibody [KO Validated]
Product SKU:CAB0739
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. This gene is expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities. Two predominant isoforms and a number of minor isoforms are produced by alternatively spliced transcripts.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 477-576 of human NF2 (NP_000259.1).
Sequence:

TKPTYPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLNELKTEIEALKLKERETALDILHNENSDRGGSSKHNT

Gene ID:4771
Swiss Prot:P35240
Synonyms:NF2; ACN; BANF; SCH; merlin
Calculated MW:19-30kDa/59-72kDa
Observed MW:80kDa
Reactivity:Human, Mouse, Rat
Application:WB IF IP
Recommended Dilution:WB 1:500 - 1:2000 IF 1:50 - 1:200 IP 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunofluorescence Immunoprecipitation
Positive Samples:A549, A431, HeLa, SKOV3, Mouse kidney, Mouse heart, Rat brain
Cellular Location:Cell projection, Cytoplasm, Cytoplasmic granule, Cytoplasmic side, Nucleus, Nucleus, Peripheral membrane protein, cytoskeleton, filopodium membrane, perinuclear region, ruffle membrane

Product Images

Anti-NF2 Antibody [KO Validated] (CAB0739)

Western blot analysis of extracts of various cell lines, using NF2 antibody (CAB0739) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.

Anti-NF2 Antibody [KO Validated] (CAB0739)

Western blot analysis of extracts from normal (control) and NF2 knockout (KO) HeLa cells, using NF2 antibody (CAB0739) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 6s.

Anti-NF2 Antibody [KO Validated] (CAB0739)

Immunofluorescence analysis of C6 cells using NF2 antibody (CAB0739) at dilution of 1:100. Blue: DAPI for nuclear staining.

Anti-NF2 Antibody [KO Validated] (CAB0739)

Immunofluorescence analysis of L929 cells using NF2 antibody (CAB0739) at dilution of 1:100. Blue: DAPI for nuclear staining.

Anti-NF2 Antibody [KO Validated] (CAB0739)

Immunofluorescence analysis of U2OS cells using NF2 antibody (CAB0739) at dilution of 1:100. Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:Merlin: a moesin-ezrin-radizin-like protein. Interacts with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. Expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations are associated with neurofibromatosis type II. Two predominant isoforms and eight minor isoforms are produced by alternatively spliced transcripts.
UniProt Protein Details:

Protein type:Tumor suppressor; Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 22q12.2

Cellular Component: adherens junction; apical part of cell; cleavage furrow; cortical actin cytoskeleton; cytoplasm; cytoskeleton; early endosome; extrinsic to membrane; filopodium membrane; lamellipodium; lipid raft; membrane; neuron projection; nucleolus; nucleus; perinuclear region of cytoplasm; plasma membrane; protein complex; synapse

Molecular Function:actin binding; beta-catenin binding; integrin binding; protein binding; protein domain specific binding

Biological Process: actin cytoskeleton organization and biogenesis; ectoderm development; hippocampus development; intercellular junction assembly and maintenance; mesoderm formation; negative regulation of cell migration; negative regulation of cell proliferation; negative regulation of cell-cell adhesion; negative regulation of cell-matrix adhesion; negative regulation of DNA replication; negative regulation of JAK-STAT cascade; negative regulation of MAPKKK cascade; negative regulation of protein kinase activity; negative regulation of tyrosine phosphorylation of Stat3 protein; negative regulation of tyrosine phosphorylation of Stat5 protein; odontogenesis of dentine-containing teeth; positive regulation of cell differentiation; positive regulation of stress fiber formation; regulation of gliogenesis; regulation of protein stability; Schwann cell proliferation; small GTPase mediated signal transduction

Disease: Meningioma, Familial, Susceptibility To; Neurofibromatosis, Type Ii; Schwannomatosis 1

NCBI Summary:This gene encodes a protein that is similar to some members of the ERM (ezrin, radixin, moesin) family of proteins that are thought to link cytoskeletal components with proteins in the cell membrane. This gene product has been shown to interact with cell-surface proteins, proteins involved in cytoskeletal dynamics and proteins involved in regulating ion transport. This gene is expressed at high levels during embryonic development; in adults, significant expression is found in Schwann cells, meningeal cells, lens and nerve. Mutations in this gene are associated with neurofibromatosis type II which is characterized by nervous system and skin tumors and ocular abnormalities. Two predominant isoforms and a number of minor isoforms are produced by alternatively spliced transcripts. [provided by RefSeq, Jul 2008]
UniProt Code:P35240
NCBI GenInfo Identifier:462594
NCBI Gene ID:4771
NCBI Accession:P35240.1
UniProt Secondary Accession:P35240,O95683, Q8WUJ2, Q969N0, Q969Q3, Q96T30, Q96T31 Q96T32, Q96T33, Q9BTW3, Q9UNG9, Q9UNH3,
UniProt Related Accession:P35240
Molecular Weight:24,515 Da
NCBI Full Name:Merlin
NCBI Synonym Full Names:neurofibromin 2 (merlin)
NCBI Official Symbol:NF2
NCBI Official Synonym Symbols:ACN; SCH; BANF
NCBI Protein Information:merlin
UniProt Protein Name:Merlin
UniProt Synonym Protein Names:Moesin-ezrin-radixin-like protein; Neurofibromin-2; Schwannomerlin; Schwannomin
Protein Family:Merlin
UniProt Gene Name:NF2
UniProt Entry Name:MERL_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose