Anti-LRRC4 Antibody (CAB10321)

SKU:
CAB10321
€99 - €249

Description

Technical Manual

Anti-LRRC4 Antibody

Product Name:Anti-LRRC4 Antibody
Product SKU:CAB10321
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene is significantly downregulated in primary brain tumors. The exact function of the protein encoded by this gene is unknown.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 544-653 of human LRRC4 (NP_071426.1).
Sequence:

LIVFYKLRKRHQQRSTVTAARTVEIIQVDEDIPAATSAAATAAPSGVSGEGAVVLPTIHDHINYNTYKPAHGAHWTENSLGNSLHPTVTTISEPYIIQTHTKDKVQETQI

Gene ID:64101
Swiss Prot:Q9HBW1
Synonyms:LRRC4; NAG14; NGL-2
Calculated MW:72kDa
Observed MW:73kDa
Reactivity:Human, Mouse, Rat
Application:WB
Recommended Dilution:WB 1:1000 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting
Positive Samples:U-87MG, U-251MG, K-562, Mouse brain, Mouse liver, Rat brain, Rat liver
Cellular Location:Cell junction, Membrane, Single-pass type I membrane protein, postsynaptic cell membrane, synapse

Product Images

Anti-LRRC4 Antibody (CAB10321)

Western blot analysis of extracts of various cell lines, using LRRC4 antibody (CAB10321) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.

Uniprot Information

UniProt Protein Function:LRRC4: Synaptic adhesion protein. Regulates the formation of exitatory synapses through the recruitment of pre-and-postsynaptic proteins. Organize the lamina/pathway-specific differentiation of dendrites. Plays a important role for auditory synaptic responses. Involved in the suppression of glioma.
UniProt Protein Details:

Protein type:Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q32.1

Cellular Component: cytoplasm

Molecular Function:protein binding; protein kinase inhibitor activity

Biological Process: cytokine and chemokine mediated signaling pathway; negative regulation of JAK-STAT cascade; negative regulation of protein kinase activity

NCBI Summary:This gene is significantly downregulated in primary brain tumors. The exact function of the protein encoded by this gene is unknown. [provided by RefSeq, Jul 2008]
UniProt Code:Q9HBW1
NCBI GenInfo Identifier:51701696
NCBI Gene ID:64101
NCBI Accession:Q9HBW1.2
UniProt Secondary Accession:Q9HBW1,Q14DU9, Q6ZMI8, Q96A85, A4D0Y9,
UniProt Related Accession:Q9HBW1
Molecular Weight:73kDa
NCBI Full Name:Leucine-rich repeat-containing protein 4
NCBI Synonym Full Names:leucine rich repeat containing 4
NCBI Official Symbol:LRRC4
NCBI Official Synonym Symbols:NAG14; NGL-2
NCBI Protein Information:leucine-rich repeat-containing protein 4
UniProt Protein Name:Leucine-rich repeat-containing protein 4
UniProt Synonym Protein Names:Brain tumor-associated protein BAG; Nasopharyngeal carcinoma-associated gene 14 protein; Netrin-G2 ligand; NGL-2
Protein Family:Leucine-rich repeat-containing protein
UniProt Gene Name:LRRC4
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose