Anti-METTL21C Antibody (CAB10403)

SKU:
CAB10403
€99 - €249

Description

Technical Manual

Anti-METTL21C Antibody

Product Name:Anti-METTL21C Antibody
Product SKU:CAB10403
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-264 of human METTL21C (NP_001010977.1).
Sequence:

MDVCLSSAQQPGRRGEGLSSPGGWLEAEKKGAPQKDSTGGVLEESNKIEPSLHSLQKFVPTDYASYTQEHYRFAGKEIVIQESIESYGAVVWPGAMALCQYLEEHAEELNFQDAKILEIGAGPGLVSIVASILGAQVTATDLPDVLGNLQYNLLKNTLQCTAHLPEVKELVWGEDLDKNFPKSAFYYDYVLASDVVYHHYFLDKLLTTMVYLSQPGTVLLWANKFRFSTDYEFLDKFKQVFDTTLLAEYPESSVKLFKGILKWD

Gene ID:196541
Swiss Prot:Q5VZV1
Synonyms:METTL21C; C13orf39
Calculated MW:29kDa
Observed MW:29kDa
Reactivity:Mouse, Rat
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:Mouse skeletal muscle, Mouse pancreas, Rat skeletal muscle
Cellular Location:Nucleus

Product Images

Anti-METTL21C Antibody (CAB10403)

Western blot analysis of extracts of various cell lines, using METTL21C antibody (CAB10403) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.

Uniprot Information

UniProt Protein Function:METTL21C: Probable methyltransferase. Belongs to the methyltransferase superfamily. METTL21 family.
UniProt Protein Details:

Protein type:EC 2.1.1.-

Chromosomal Location of Human Ortholog: 13q33.1

Molecular Function:protein binding; protein-lysine N-methyltransferase activity

Biological Process: protein amino acid methylation

UniProt Code:Q5VZV1
NCBI GenInfo Identifier:74757117
NCBI Gene ID:196541
NCBI Accession:Q5VZV1.1
UniProt Related Accession:Q5VZV1
Molecular Weight:30kDa
NCBI Full Name:Protein-lysine methyltransferase METTL21C
NCBI Synonym Full Names:methyltransferase like 21C
NCBI Official Symbol:METTL21C 
NCBI Official Synonym Symbols:C13orf39 
NCBI Protein Information:protein-lysine methyltransferase METTL21C
UniProt Protein Name:Protein-lysine methyltransferase METTL21C
UniProt Synonym Protein Names:Methyltransferase-like protein 21C
Protein Family:Protein-lysine methyltransferase
UniProt Gene Name:METTL21C 
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose