NAPSA Rabbit Polyclonal Antibody (CAB5594)

(No reviews yet) Write a Review
SKU:
CAB5594
€99 - €249

Description

Technical Manual

NAPSA Rabbit Polyclonal Antibody

Product Name:NAPSA Rabbit Polyclonal Antibody
Product SKU:CAB5594
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the peptidase A1 family of aspartic proteases. The encoded preproprotein is proteolytically processed to generate an activation peptide and the mature protease. The activation peptides of aspartic proteinases function as inhibitors of the protease active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The encoded protease may play a role in the proteolytic processing of pulmonary surfactant protein B in the lung and may function in protein catabolism in the renal proximal tubules. This gene has been described as a marker for lung adenocarcinoma and renal cell carcinoma.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 25-250 of human NAPSA (NP_004842.1).
Sequence:

TLIRIPLHRVQPGRRILNLLRGWREPAELPKLGAPSPGDKPIFVPLSNYRDVQYFGEIGLGTPPQNFTVAFDTGSSNLWVPSRRCHFFSVPCWLHHRFDPKASSSFQANGTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVFAFAHFDGILGLGFPILSVEGVRPPMDVLVEQGLLDKPVFSFYLNRDPEEPDGGELVLGGSDPAHYIPPLTFV

Gene ID:9476
Swiss Prot:O96009
Synonyms:NAPSA; KAP; Kdap; NAP1; NAPA; SNAPA; napsin-A; Napsin A
Calculated MW:45kDa
Observed MW:45kDa
Reactivity:Human, Mouse, Rat
Application:WB IF
Recommended Dilution:WB 1:1000 - 1:2000 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunofluorescence 
Positive Samples:293T
Cellular Location:Secreted

Product Images

NAPSA Rabbit Polyclonal Antibody (CAB5594)

Western blot analysis of extracts of 293T cells, using NAPSA antibody (CAB5594) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3s.

Uniprot Information

UniProt Protein Function:NAPSA: May be involved in processing of pneumocyte surfactant precursors. Belongs to the peptidase A1 family.
UniProt Protein Details:

Protein type:EC 3.4.23.-; Protease; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19q13.33

Cellular Component: extracellular space; lysosome

Molecular Function:aspartic-type endopeptidase activity; endopeptidase activity; peptidase activity

Biological Process: cellular protein metabolic process; membrane protein proteolysis; protein catabolic process; surfactant homeostasis

NCBI Summary:This gene encodes a member of the peptidase A1 family of aspartic proteases. The encoded preproprotein is proteolytically processed to generate an activation peptide and the mature protease. The activation peptides of aspartic proteinases function as inhibitors of the protease active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The encoded protease may play a role in the proteolytic processing of pulmonary surfactant protein B in the lung and may function in protein catabolism in the renal proximal tubules. This gene has been described as a marker for lung adenocarcinoma and renal cell carcinoma. [provided by RefSeq, Feb 2016]
UniProt Code:O96009
NCBI GenInfo Identifier:6225749
NCBI Gene ID:9476
NCBI Accession:O96009.1
UniProt Secondary Accession:O96009,Q8WWD9,
UniProt Related Accession:O96009
Molecular Weight:45,387 Da
NCBI Full Name:Napsin-A
NCBI Synonym Full Names:napsin A aspartic peptidase
NCBI Official Symbol:NAPSA 
NCBI Official Synonym Symbols:KAP; Kdap; NAP1; NAPA; SNAPA 
NCBI Protein Information:napsin-A
UniProt Protein Name:Napsin-A
UniProt Synonym Protein Names:Aspartyl protease 4; ASP4; Asp 4; Napsin-1; TA01/TA02
Protein Family:Napsin
UniProt Gene Name:NAPSA 
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose