NME4 Polyclonal Antibody (CAB8350)

(No reviews yet) Write a Review
SKU:
CAB8350
  • Western blot analysis of extracts of various cell lines, using NME4 antibody (CAB8350) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.
  • Immunohistochemistry of paraffin-embedded human liver using NME4 antibody (CAB8350) at dilution of 1:100 (40x lens).
  • Immunohistochemistry of paraffin-embedded human esophagus using NME4 antibody (CAB8350) at dilution of 1:100 (40x lens).
€99 - €249

Description

Technical Manual

NME4 Rabbit Polyclonal Antibody

Product Name:NME4 Rabbit Polyclonal Antibody
Product SKU:CAB8350
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-187 of human NME4 (NP_005000.1).
Sequence:

MGGLFWRSALRGLRCGPRAPGPSLLVRHGSGGPSWTRERTLVAVKPDGVQRRLVGDVIQRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSAEAAPGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSELVSWADGGQHSSIHPA

Gene ID:4833
Swiss Prot:O00746
Synonyms:NME4; NDPK-D; NM23H4; nm23-H4
Calculated MW:12kDa/20kDa
Observed MW:17kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:100
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry 
Positive Samples:Jurkat, A-549, NCI-H460, BT-474, Mouse kidney, Mouse stomach, Rat brain
Cellular Location:Mitochondrion intermembrane space, Mitochondrion matrix, Peripheral membrane protein

Product Images

NME4 Polyclonal Antibody (CAB8350)

Western blot analysis of extracts of various cell lines, using NME4 antibody (CAB8350) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.

NME4 Polyclonal Antibody (CAB8350)

Immunohistochemistry of paraffin-embedded human liver using NME4 antibody (CAB8350) at dilution of 1:100 (40x lens).

NME4 Polyclonal Antibody (CAB8350)

Immunohistochemistry of paraffin-embedded human esophagus using NME4 antibody (CAB8350) at dilution of 1:100 (40x lens).

Uniprot Information

UniProt Protein Function:NME4: Major role in the synthesis of nucleoside triphosphates other than ATP. Belongs to the NDK family.
UniProt Protein Details:

Protein type:Kinase, nucleoside diphosphate; Nucleotide Metabolism - purine; Nucleotide Metabolism - pyrimidine; EC 2.7.4.6; Kinase, other; Mitochondrial; Other group; NDK family

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: mitochondrial inner membrane; mitochondrion

Molecular Function:nucleoside diphosphate kinase activity; protein binding

Biological Process: nucleobase, nucleoside and nucleotide interconversion; nucleoside metabolic process; nucleoside triphosphate biosynthetic process; purine nucleotide metabolic process; pyrimidine nucleotide metabolic process; regulation of apoptosis

NCBI Summary:The nucleoside diphosphate (NDP) kinases (EC 2.7.4.6) are ubiquitous enzymes that catalyze transfer of gamma-phosphates, via a phosphohistidine intermediate, between nucleoside and dioxynucleoside tri- and diphosphates. The enzymes are products of the nm23 gene family, which includes NME4 (Milon et al., 1997 [PubMed 9099850]).[supplied by OMIM, May 2008]
UniProt Code:O00746
NCBI GenInfo Identifier:2498075
NCBI Gene ID:4833
NCBI Accession:O00746.1
UniProt Secondary Accession:O00746,Q5U0M9, A2IDD0,
UniProt Related Accession:O00746
Molecular Weight:12,979 Da
NCBI Full Name:Nucleoside diphosphate kinase, mitochondrial
NCBI Synonym Full Names:NME/NM23 nucleoside diphosphate kinase 4
NCBI Official Symbol:NME4 
NCBI Official Synonym Symbols:NDPK-D; NM23H4; nm23-H4 
NCBI Protein Information:nucleoside diphosphate kinase, mitochondrial
UniProt Protein Name:Nucleoside diphosphate kinase, mitochondrial
UniProt Synonym Protein Names:Nucleoside diphosphate kinase D; NDPKD; nm23-H4
UniProt Gene Name:NME4 
UniProt Entry Name:NDKM_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Application:
WB
Application:
IHC
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
View AllClose

0 Reviews

View AllClose