Anti-STRIP1 Antibody (CAB10334)

SKU:
CAB10334
€99 - €249

Description

Technical Manual

Anti-STRIP1 Antibody

Product Name:Anti-STRIP1 Antibody
Product SKU:CAB10334
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the striatin-interacting phosphatase and kinase complex, which is involved in localization of the Golgi body. The encoded protein participates in cytosketelal organization. Alternative splicing results in multiple transcript variants.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 743-837 of human STRIP1 (NP_149079.2).
Sequence:

VRHRLNDDWAYGNDLDARPWDFQAEECALRANIERFNARRYDRAHSNPDFLPVDNCLQSVLGQRVDLPEDFQMNYDLWLEREVFSKPISWEELLQ

Gene ID:85369
Swiss Prot:Q5VSL9
Synonyms:STRIP1; FAM40A; FAR11A
Calculated MW:23kDa/49kDa/85kDa/95kDa
Observed MW:110kDa
Reactivity:Human, Mouse, Rat
Application:WB
Recommended Dilution:WB 1:1000 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting
Positive Samples:U-87MG, LO2, MCF7, Mouse brain, Rat brain
Cellular Location:Cytoplasm

Product Images

Anti-STRIP1 Antibody (CAB10334)

Western blot analysis of extracts of various cell lines, using STRIP1 antibody (CAB10334) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s.

Uniprot Information

UniProt Protein Function:STRIP1: Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the cortical actin filament dynamics and cell shape. Belongs to the FAM40 family. 4 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Chromosomal Location of Human Ortholog: 1p13.3

Cellular Component: cytoplasm; nucleus

Molecular Function:protein binding

Biological Process: cortical actin cytoskeleton organization and biogenesis; regulation of cell morphogenesis

NCBI Summary:This gene encodes a member of the striatin-interacting phosphatase and kinase complex, which is involved in localization of the Golgi body. The encoded protein participates in cytosketelal organization. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2012]
UniProt Code:Q5VSL9
NCBI GenInfo Identifier:71648671
NCBI Gene ID:85369
NCBI Accession:Q5VSL9.1
UniProt Secondary Accession:Q5VSL9,Q0V925, Q5VSL8, Q658K2, Q6ZV31, Q8N598, Q96SN2 Q9C0A2,
UniProt Related Accession:Q5VSL9
Molecular Weight:23,540 Da
NCBI Full Name:Striatin-interacting protein 1
NCBI Synonym Full Names:striatin interacting protein 1
NCBI Official Symbol:STRIP1
NCBI Official Synonym Symbols:FAM40A; FAR11A
NCBI Protein Information:striatin-interacting protein 1
UniProt Protein Name:Striatin-interacting protein 1
UniProt Synonym Protein Names:Protein FAM40A
Protein Family:Striatin-interacting protein
UniProt Gene Name:STRIP1
UniProt Entry Name:STRP1_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose