Anti-RIC8A Antibody (CAB10393)

SKU:
CAB10393
€99 - €249

Description

Technical Manual

Anti-RIC8A Antibody

Product Name:Anti-RIC8A Antibody
Product SKU:CAB10393
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 362-531 of human RIC8A (NP_001273063.1).
Sequence:

DVRTRPEVGEMLRNKLVRLMTHLDTDVKRVAAEFLFVLCSESVPRFIKYTGYGNAAGLLAARGLMAGGRPEGQYSEDEDTDTDEYKEAKASINPVTGRVEEKPPNPMEGMTEEQKEHEAMKLVTMFDKLSRNRVIQPMGMSPRGHLTSLQDAMCETMEQQLSSDPDSDPD

Gene ID:60626
Swiss Prot:Q9NPQ8
Synonyms:RIC8A; RIC8
Calculated MW:58kDa/59kDa/60kDa
Observed MW:60kDa
Reactivity:Human, Mouse, Rat
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting
Positive Samples:Raji, HeLa, HepG2, 293T, DU145, Mouse brain, Rat brain
Cellular Location:Cell membrane, Cytoplasm

Product Images

Anti-RIC8A Antibody (CAB10393)

Western blot analysis of extracts of various cell lines, using RIC8A antibody (CAB10393) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 20s.

Uniprot Information

UniProt Protein Function:RIC8A: Guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins. Able to activate GNAI1, GNAO1 and GNAQ, but not GNAS by exchanging bound GDP for free GTP. Involved in regulation of microtubule pulling forces during mitotic movement of chromosomes by stimulating G(i)-alpha protein, possibly leading to release G(i)-alpha-GTP and NuMA proteins from the NuMA-GPSM2-G(i)-alpha-GDP complex. Also acts as an activator for G(q)-alpha (GNAQ) protein by enhancing the G(q)-coupled receptor-mediated ERK activation. Belongs to the synembryn family. 4 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:GEFs; GEFs, misc.

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: cytoplasm; plasma membrane

Molecular Function:G-protein alpha-subunit binding; GTPase activator activity; guanyl-nucleotide exchange factor activity; protein binding

Biological Process: G-protein coupled receptor protein signaling pathway

UniProt Code:Q9NPQ8
NCBI GenInfo Identifier:308153562
NCBI Gene ID:60626
NCBI Accession:Q9NPQ8.3
UniProt Secondary Accession:Q9NPQ8,Q0P508, Q2T9J1, Q7Z352, Q96EZ1, Q96SZ2, Q9H064 Q9H5H3, Q9H9E7,
UniProt Related Accession:Q9NPQ8
Molecular Weight:59,612 Da
NCBI Full Name:Synembryn-A
NCBI Synonym Full Names:RIC8 guanine nucleotide exchange factor A
NCBI Official Symbol:RIC8A
NCBI Official Synonym Symbols:RIC8
NCBI Protein Information:synembryn-A
UniProt Protein Name:Synembryn-A
UniProt Synonym Protein Names:Protein Ric-8A
Protein Family:Synembryn
UniProt Gene Name:RIC8A
UniProt Entry Name:RIC8A_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose