Anti-TREM2 Antibody (CAB10482)

SKU:
CAB10482
  • Cell Biology Antibodies 1 Anti-TREM2 Antibody CAB10482
  • Cell Biology Antibodies 1 Anti-TREM2 Antibody CAB10482
  • Cell Biology Antibodies 1 Anti-TREM2 Antibody CAB10482
  • Cell Biology Antibodies 1 Anti-TREM2 Antibody CAB10482
  • Cell Biology Antibodies 1 Anti-TREM2 Antibody CAB10482
€99 - €249

Description

Technical Manual

Anti-TREM2 Antibody

Product Name:Anti-TREM2 Antibody
Product SKU:CAB10482
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human TREM2 (NP_061838.1).
Sequence:

HNTTVFQGVAGQSLQVSCPYDSMKHWGRRKAWCRQLGEKGPCQRVVSTHNLWLLSFLRRWNGSTAITDDTLGGTLTITLRNLQPHDAGLYQCQSLHGSEADTLRKVLVEVLADPLDHRDAGDLWFPGESESFEDAHVEHSIS

Gene ID:54209
Swiss Prot:Q9NZC2
Synonyms:TREM2; TREM-2; Trem2a; Trem2b; Trem2c
Calculated MW:24kDa/25kDa
Observed MW:30-50KDa/28KDa
Reactivity:Human, Mouse, Rat
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:1000 IHC 1:50 - 1:200 IF 1:20 - 1:100
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence
Positive Samples:THP-1, Mouse brain
Cellular Location:Cell membrane, Secreted, Single-pass type I membrane protein

Product Images

Anti-TREM2 Antibody (CAB10482)

Western blot analysis of extracts of various cell lines, using TREM2 antibody (CAB10482) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 180s.

Anti-TREM2 Antibody (CAB10482)

Immunohistochemistry of paraffin-embedded rat spleen using TREM2 Rabbit pAb (CAB10482) at dilution of 1:100 (40x lens).

Anti-TREM2 Antibody (CAB10482)

Immunofluorescence analysis of U-251MG cells using TREM2 antibody (CAB10482) at dilution of 1:100. Blue: DAPI for nuclear staining.

Anti-TREM2 Antibody (CAB10482)

Immunofluorescence analysis of mouse lung cells using TREM2 antibody (CAB10482) at dilution of 1:100. Blue: DAPI for nuclear staining.

Anti-TREM2 Antibody (CAB10482)

Immunofluorescence analysis of Rat lung using TREM2 antibody (CAB10482) at dilution of 1:100. Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:TREM2: May have a role in chronic inflammations and may stimulate production of constitutive rather than inflammatory chemokines and cytokines. Forms a receptor signaling complex with TYROBP and triggers activation of the immune responses in macrophages and dendritic cells. Defects in TREM2 are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL); also known as presenile dementia with bone cysts or Nasu-Hakola disease (NHD). PLOSL is a recessively inherited disease characterized by a combination of psychotic symptoms rapidly progressing to presenile dementia and bone cysts restricted to wrists and ankles. PLOSL has a global distribution, although most of the patients have been diagnosed in Finland and Japan, with an estimated population prevalence of 2x10(-6) in the Finns. 3 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: integral to membrane; intracellular membrane-bound organelle; plasma membrane

Molecular Function:receptor activity

Biological Process: humoral immune response; innate immune response; positive regulation of antigen processing and presentation of peptide antigen via MHC class II; positive regulation of calcium-mediated signaling; positive regulation of peptidyl-tyrosine phosphorylation; regulation of immune response

Disease: Polycystic Lipomembranous Osteodysplasia With Sclerosing Leukoencephalopathy

NCBI Summary:This gene encodes a membrane protein that forms a receptor signaling complex with the TYRO protein tyrosine kinase binding protein. The encoded protein functions in immune response and may be involved in chronic inflammation by triggering the production of constitutive inflammatory cytokines. Defects in this gene are a cause of polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL). Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Nov 2012]
UniProt Code:Q9NZC2
NCBI GenInfo Identifier:50401689
NCBI Gene ID:54209
NCBI Accession:Q9NZC2.1
UniProt Secondary Accession:Q9NZC2,Q8N5H8, Q8WYN6,
UniProt Related Accession:Q9NZC2
Molecular Weight:25kDa
NCBI Full Name:Triggering receptor expressed on myeloid cells 2
NCBI Synonym Full Names:triggering receptor expressed on myeloid cells 2
NCBI Official Symbol:TREM2
NCBI Official Synonym Symbols:TREM-2; Trem2a; Trem2b; Trem2c
NCBI Protein Information:triggering receptor expressed on myeloid cells 2
UniProt Protein Name:Triggering receptor expressed on myeloid cells 2
UniProt Synonym Protein Names:Triggering receptor expressed on monocytes 2
Protein Family:Triggering receptor expressed on myeloid cells
UniProt Gene Name:TREM2
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose