USP8 Rabbit Polyclonal Antibody (CAB7031)

(No reviews yet) Write a Review
SKU:
CAB7031
  • Western blot analysis of extracts of various cell lines, using USP8 antibody (CAB7031) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.
  • Immunofluorescence analysis of A-549 cells using USP8 antibody (CAB7031). Blue: DAPI for nuclear staining.
€99 - €249

Description

Technical Manual

USP8 Rabbit Polyclonal Antibody

Product Name:USP8 Rabbit Polyclonal Antibody
Product SKU:CAB7031
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a protein that belongs to the ubiquitin-specific processing protease family of proteins. The encoded protein is thought to regulate the morphology of the endosome by ubiquitination of proteins on this organelle and is involved in cargo sorting and membrane trafficking at the early endosome stage. This protein is required for the cell to enter the S phase of the cell cycle and also functions as a positive regulator in the Hedgehog signaling pathway in development. Pseudogenes of this gene are present on chromosomes 2 and 6. Alternate splicing results in multiple transcript variants.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human USP8 (NP_005145.3).
Sequence:

MPAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECRLDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEEAERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAKGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLIIMDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRGNVEYVVLLDWFSSAKDLQI

Gene ID:9101
Swiss Prot:P40818
Synonyms:USP8; HumORF8; SPG59; UBPY
Calculated MW:115kDa/127kDa
Observed MW:131kDa
Reactivity:Human, Mouse, Rat
Application:WB IF
Recommended Dilution:WB 1:500 - 1:2000 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunofluorescence 
Positive Samples:MCF7, THP-1, A-549, H125, Mouse brain, Mouse lung, Rat brain
Cellular Location:Cell membrane, Cytoplasm, Endosome membrane, Nucleus, Peripheral membrane protein

Product Images

USP8 Rabbit Polyclonal Antibody (CAB7031)

Western blot analysis of extracts of various cell lines, using USP8 antibody (CAB7031) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.

USP8 Rabbit Polyclonal Antibody (CAB7031)

Immunofluorescence analysis of A-549 cells using USP8 antibody (CAB7031). Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:USP8: Hydrolase that can remove conjugated ubiquitin from proteins and therefore plays an important regulatory role at the level of protein turnover by preventing degradation. Converts both 'Lys-48' an 'Lys-63'-linked ubiquitin chains. Catalytic activity is enhanced in the M phase. Involved in cell proliferation. Required to enter into S phase in response to serum stimulation. May regulate T-cell anergy mediated by RNF128 via the formation of a complex containing RNF128 and OTUB1. Probably regulates the stability of STAM2 and RASGRF1. Regulates endosomal ubiquitin dynamics, cargo sorting, membrane traffic at early endosomes, and maintenance of ESCRT-0 stability. The level of protein ubiquitination on endosomes is essential for maintaining the morphology of the organelle. Deubiquitinates EPS15 and controles tyrosine kinase stability. Removes conjugated ubiquitin from EGFR thus regulating EGFR degradation and downstream MAPK signaling. Involved in acrosome biogenesis through interaction with the spermatid ESCRT-0 complex and microtubules. Deubiquitinates BIRC6/bruce and KIF23/MKLP1. Forms a ternary complex with RNF128 and OTUB1. Interacts (via C-terminal UCH catalytic domain) with OTUB1 isoform 1. Interacts with STAM2 (via SH3 domain). Interacts with DNAJB3, EGFR, EPS15, RASGRF1, RNF41, YWHAE, YWHAG and YWHAZ. Interacts with NBR1, RASGRF1, RNF41 and IST1. Associates with the ESCRT-0 complex and with microtubules. Interacts with BIRC6/bruce and KIF23/MKLP1. Upon growth stimulation in starved human fibroblasts. Decreases in response to growth arrest induced by cell-cell contact. Belongs to the peptidase C19 family.
UniProt Protein Details:

Protein type:Ubiquitin-specific protease; EC 3.4.19.12; Ubiquitin conjugating system; Protease

Chromosomal Location of Human Ortholog: 15q21.2

Cellular Component: extrinsic to plasma membrane; nucleoplasm; Golgi apparatus; early endosome; cytoplasm; acrosome; midbody; cytosol

Molecular Function:protein binding; cysteine-type endopeptidase activity; ubiquitin-specific protease activity; SH3 domain binding

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; cell proliferation; protein deubiquitination; endosome organization and biogenesis; cytokinesis after mitosis; Ras protein signal transduction

NCBI Summary:This gene encodes a protein that belongs to the ubiquitin-specific processing protease family of proteins. The encoded protein is thought to regulate the morphology of the endosome by ubiquitination of proteins on this organelle and is involved in cargo sorting and membrane trafficking at the early endosome stage. This protein is required for the cell to enter the S phase of the cell cycle and also functions as a positive regulator in the Hedgehog signaling pathway in development. Pseudogenes of this gene are present on chromosomes 2 and 6. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013]
UniProt Code:P40818
NCBI GenInfo Identifier:731046
NCBI Gene ID:9101
NCBI Accession:P40818.1
UniProt Secondary Accession:P40818,Q2TB31, Q7Z3U2, Q86VA0, Q8IWI7, B4DKA8,
UniProt Related Accession:P40818
Molecular Weight:1118
NCBI Full Name:Ubiquitin carboxyl-terminal hydrolase 8
NCBI Synonym Full Names:ubiquitin specific peptidase 8
NCBI Official Symbol:USP8 
NCBI Official Synonym Symbols:UBPY; SPG59; HumORF8 
NCBI Protein Information:ubiquitin carboxyl-terminal hydrolase 8; ubiquitin isopeptidase Y; deubiquitinating enzyme 8; ubiquitin thiolesterase 8; ubiquitin-specific-processing protease 8
UniProt Protein Name:Ubiquitin carboxyl-terminal hydrolase 8
UniProt Synonym Protein Names:Deubiquitinating enzyme 8; Ubiquitin isopeptidase Y; hUBPy; Ubiquitin thioesterase 8; Ubiquitin-specific-processing protease 8
UniProt Gene Name:USP8 
UniProt Entry Name:UBP8_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose