Anti-ZC3H14 Antibody (CAB10364)

SKU:
CAB10364
€99 - €249

Description

Technical Manual

Anti-ZC3H14 Antibody

Product Name:Anti-ZC3H14 Antibody
Product SKU:CAB10364
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

The protein encoded by this gene is a poly(A)-binding protein that can affect gene expression and poly(A) tail length. The encoded protein may influence mRNA stability, nuclear export, and translation.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-306 of human ZC3H14 (NP_997545.2).
Sequence:

MRMSSKFPSPPLPIFLPPEPVDLGSITSSSCSLNELDNISHLLRKISADINEIKGMKAAILTVEANLFDLNVRVSKNEAKISSLEVKMNEYSTTYECNRQFEDQEEDTESQSRTTDVKIIGFLRNVEKGTQQRQLLSRLQIDPVMAETLQMSQAEMSELSVAQKPEKLLERCKYWPACKNGDECAYHHPISPCKAFPNCKFAEKCLFVHPNCKYDAKCTKPDCPFTHVSRRIPVLSPKPVAPPAPPSSSQLCRYFPACKKMECPFYHPKHCRFNTQCTRPDCTFYHPTINVPPRHALKWIRPQTSE

Gene ID:79882
Swiss Prot:Q6PJT7
Synonyms:ZC3H14; MRT56; MSUT-2; NY-REN-37; SUT2; UKp68
Calculated MW:32-34kDa/61-66kDa/80-82kDa
Observed MW:105kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry
Positive Samples:MCF7, A-549, HT-1080, 293T
Cellular Location:Cytoplasm, Nucleus speckle

Product Images

Anti-ZC3H14 Antibody (CAB10364)

Western blot analysis of extracts of various cell lines, using ZC3H14 antibody (CAB10364) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.

Uniprot Information

UniProt Protein Function:ZC3H14: Binds the polyadenosine RNA oligonucleotides. Belongs to the ZC3H14 family. 7 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:DNA-binding; RNA-binding

Chromosomal Location of Human Ortholog: 14q31.3

Cellular Component: nuclear speck; nucleolus; nucleus

Molecular Function:protein binding; RNA binding

Disease: Mental Retardation, Autosomal Recessive 56

NCBI Summary:The protein encoded by this gene is a poly(A)-binding protein that can affect gene expression and poly(A) tail length. The encoded protein may influence mRNA stability, nuclear export, and translation. [provided by RefSeq, May 2016]
UniProt Code:Q6PJT7
NCBI GenInfo Identifier:74737935
NCBI Gene ID:79882
NCBI Accession:Q6PJT7.1
UniProt Secondary Accession:Q6PJT7,Q6MZU4, Q6PJ32, Q6PUI6, Q6PUI8, Q86TQ5, Q86TW0 A8MY46, B4DXU8, B4DZW7, B4E2H4, G3V5R4,
UniProt Related Accession:Q6PJT7
Molecular Weight:83kDa
NCBI Full Name:Zinc finger CCCH domain-containing protein 14
NCBI Synonym Full Names:zinc finger CCCH-type containing 14
NCBI Official Symbol:ZC3H14
NCBI Official Synonym Symbols:SUT2; MRT56; UKp68; MSUT-2; NY-REN-37
NCBI Protein Information:zinc finger CCCH domain-containing protein 14
UniProt Protein Name:Zinc finger CCCH domain-containing protein 14
UniProt Synonym Protein Names:Mammalian suppressor of tau pathology-2; MSUT-2; Renal carcinoma antigen NY-REN-37
Protein Family:Zinc finger CCCH domain-containing protein
UniProt Gene Name:ZC3H14
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose