Anti-AK2 Antibody (CAB6519)[KO Validated]

SKU:
CAB6519
  • KO Validated Antibodies 1 Anti-AK2 Antibody CAB6519KO Validated
  • KO Validated Antibodies 1 Anti-AK2 Antibody CAB6519KO Validated
  • KO Validated Antibodies 1 Anti-AK2 Antibody CAB6519KO Validated
€129 - €349

Description

Technical Manual

Anti-AK2 Antibody [KO Validated]

Product Name:Anti-AK2 Antibody [KO Validated]
Product SKU:CAB6519
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-232 of human AK2 (NP_001616.1).
Sequence:

MAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATC

Gene ID:204
Swiss Prot:P54819
Synonyms:AK2; ADK2
Calculated MW:14kDa/21kDa/22kDa/24kDa/25kDa/26kDa
Observed MW:32kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry
Positive Samples:HL-60, Mouse liver, Mouse kidney, Rat liver
Cellular Location:Mitochondrion intermembrane space

Product Images

Anti-AK2 Antibody [KO Validated] (CAB6519)

Western blot analysis of extracts of various cell lines, using AK2 antibody (CAB6519) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

Anti-AK2 Antibody [KO Validated] (CAB6519)

Western blot analysis of extracts from normal (control) and AK2 knockout (KO) 293T cells, using AK2 antibody (CAB6519) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

Anti-AK2 Antibody [KO Validated] (CAB6519)

Immunohistochemistry of paraffin-embedded human gastric cancer using AK2 antibody (CAB6519) at dilution of 1:100 (40x lens).

Uniprot Information

UniProt Protein Function:AK2: Catalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. This small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth. Plays a key role in hematopoiesis. Defects in AK2 are the cause of reticular dysgenesis (RDYS); also known as aleukocytosis. RDYS is the most severe form of inborn severe combined immunodeficiencies (SCID) and is characterized by absence of granulocytes and almost complete deficiency of lymphocytes in peripheral blood, hypoplasia of the thymus and secondary lymphoid organs, and lack of innate and adaptive humoral and cellular immune functions, leading to fatal septicemia within days after birth. In bone marrow of individuals with reticular dysgenesis, myeloid differentiation is blocked at the promyelocytic stage, whereas erythro- and megakaryocytic maturation is generally normal.In addition, affected newborns have bilateral sensorineural deafness. Defects may be due to its absence in leukocytes and inner ear, in which its absence can not be compensated by AK1. Belongs to the adenylate kinase family. AK2 subfamily. 6 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Mitochondrial; Nucleotide Metabolism - purine; EC 2.7.4.3; Kinase, other

Chromosomal Location of Human Ortholog: 1p34

Cellular Component: mitochondrial inner membrane; mitochondrial intermembrane space; cytosol

Molecular Function:adenylate kinase activity; ATP binding

Biological Process: dATP metabolic process; nucleobase, nucleoside and nucleotide interconversion; nucleobase, nucleoside and nucleotide metabolic process; ADP biosynthetic process; brain development; liver development; AMP metabolic process; oxidative phosphorylation; nucleotide phosphorylation

Disease: Reticular Dysgenesis

NCBI Summary:Adenylate kinases are involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. Three isozymes of adenylate kinase, namely 1, 2, and 3, have been identified in vertebrates; this gene encodes isozyme 2. Expression of these isozymes is tissue-specific and developmentally regulated. Isozyme 2 is localized in the mitochondrial intermembrane space and may play a role in apoptosis. Mutations in this gene are the cause of reticular dysgenesis. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 1 and 2.[provided by RefSeq, Nov 2010]
UniProt Code:P54819
NCBI GenInfo Identifier:1708596
NCBI Gene ID:204
NCBI Accession:P54819.2
UniProt Secondary Accession:P54819,Q16856, Q5EB54, Q5TIF7, Q8TCY2, Q8TCY3, A8K6L1 B4DHH7, B4DL64,
UniProt Related Accession:P54819
Molecular Weight:21,767 Da
NCBI Full Name:Adenylate kinase 2, mitochondrial
NCBI Synonym Full Names:adenylate kinase 2
NCBI Official Symbol:AK2
NCBI Official Synonym Symbols:ADK2; AK 2
NCBI Protein Information:adenylate kinase 2, mitochondrial; ATP:AMP phosphotransferase; ATP-AMP transphosphorylase 2; adenylate monophosphate kinase; adenylate kinase isoenzyme 2, mitochondrial
UniProt Protein Name:Adenylate kinase 2, mitochondrial
UniProt Synonym Protein Names:ATP-AMP transphosphorylase 2; ATP:AMP phosphotransferase; Adenylate monophosphate kinaseCleaved into the following chain:Adenylate kinase 2, mitochondrial, N-terminally processed
UniProt Gene Name:AK2
UniProt Entry Name:KAD2_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose