Anti-Lamin B1 Antibody (CAB1910)[KO Validated]

SKU:
CAB1910
  • KO Validated Antibodies 1 Anti-Lamin B1 Antibody CAB1910KO Validated
  • KO Validated Antibodies 1 Anti-Lamin B1 Antibody CAB1910KO Validated
  • KO Validated Antibodies 1 Anti-Lamin B1 Antibody CAB1910KO Validated
  • KO Validated Antibodies 1 Anti-Lamin B1 Antibody CAB1910KO Validated
  • KO Validated Antibodies 1 Anti-Lamin B1 Antibody CAB1910KO Validated
€129 - €349

Description

Technical Manual

Anti-Lamin B1 Antibody [KO Validated]

Product Name:Anti-Lamin B1 Antibody [KO Validated]
Product SKU:CAB1910
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 397-586 of human Lamin B1 (NP_005564.1).
Sequence:

RVTVSRASSSRSVRTTRGKRKRVDVEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEAAGVVVEEELFHQQGTPRASNRSCAIM

Gene ID:4001
Swiss Prot:P20700
Synonyms:ADLD; LMN; LMN2; LMNB; Lamin B1; LMNB1; lamin-B1
Calculated MW:66kDa
Observed MW:70kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence 
Positive Samples:HepG2, Jurkat, HT-29, U-251MG, A-549, Mouse spleen, Rat testis
Cellular Location:Lipid-anchor, Nucleoplasmic side, Nucleus inner membrane

Product Images

Anti-Lamin B1 Antibody [KO Validated] (CAB1910)

Western blot analysis of extracts from normal (control) and Lamin B1 knockout (KO) HeLa cells, using Lamin B1 antibody (CAB1910) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s.

Anti-Lamin B1 Antibody [KO Validated] (CAB1910)

Western blot analysis of extracts of various cell lines, using Lamin B1 antibody (CAB1910) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.

Anti-Lamin B1 Antibody [KO Validated] (CAB1910)

Immunohistochemistry of paraffin-embedded human breast using [KO] Lamin B1 antibody (CAB1910) at dilution of 1:100 (40x lens).

Anti-Lamin B1 Antibody [KO Validated] (CAB1910)

Immunohistochemistry of paraffin-embedded rat brain using [KO] Lamin B1 antibody (CAB1910) at dilution of 1:100 (40x lens).

Anti-Lamin B1 Antibody [KO Validated] (CAB1910)

Immunohistochemistry of paraffin-embedded mouse brain using [KO] Lamin B1 antibody (CAB1910) at dilution of 1:100 (40x lens).

Uniprot Information

UniProt Protein Function:Lamin B1: nuclear lamins are intermediate filament proteins that constitute the lattice-like matrix at the inner face of the nuclear membrane that underlies the nuclear envelop. The lamins, highly conserved throughout evolution, are encoded by three genes in the human: LMNA, LMNB1, and LMNB2. The A-type lamins (lamin A/C) are developmentally regulated and are generally expressed in differentiated cells. The anchoring of chromatin to the nuclear lamina is involved in the control of gene expression and in DNA replication and repair. During mitosis, the nuclear lamina is reversibly disassembled as the lamin proteins are phosphorylated. B-type lamins are phosphorylated within minutes of engaging the IgM surface receptor of resting splenic B cells. Nuclear lamins are cleaved by caspases during apoptosis.
UniProt Protein Details:

Protein type:Cytoskeletal

Chromosomal Location of Human Ortholog: 5q23.2

Cellular Component: nucleoplasm; nuclear membrane; membrane; lamin filament; nuclear inner membrane; nuclear envelope

Molecular Function:phospholipase binding; structural molecule activity

Biological Process: apoptosis; cell structure disassembly during apoptosis

Disease: Leukodystrophy, Demyelinating, Adult-onset, Autosomal Dominant

NCBI Summary:This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
UniProt Code:P20700
NCBI GenInfo Identifier:125953
NCBI Gene ID:4001
NCBI Accession:P20700.2
UniProt Related Accession:P20700
Molecular Weight:~ 68kDa
NCBI Full Name:Lamin-B1
NCBI Synonym Full Names:lamin B1
NCBI Official Symbol:LMNB1 
NCBI Official Synonym Symbols:LMN; ADLD; LMN2; LMNB 
NCBI Protein Information:lamin-B1
UniProt Protein Name:Lamin-B1
Protein Family:Light-harvesting protein
UniProt Gene Name:LMNB1 
UniProt Entry Name:LMNB1_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Research Area:
Cell Biology
View AllClose