[KO Validated] SMARCA4 Rabbit Polyclonal Antibody (CAB0887)

(No reviews yet) Write a Review
SKU:
CAB0887
  • Western blot analysis of extracts of various cell lines, using SMARCA4 antibody (CAB0887) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
  • Western blot analysis of extracts from normal (control) and SMARCA4 knockout (KO) 293T cells, using SMARCA4 antibody (CAB0887) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.
  • Immunohistochemistry of paraffin-embedded human colon using SMARCA4 antibody (CAB0887) at dilution of 1:100 (40x lens).
  • Immunohistochemistry of paraffin-embedded human colon carcinoma using SMARCA4 antibody (CAB0887) at dilution of 1:100 (40x lens).
  • Immunofluorescence analysis of HeLa cells using SMARCA4 antibody (CAB0887).
€129 - €349

Description

Technical Manual

[KO Validated] SMARCA4 Rabbit Polyclonal Antibody

Product Name:[KO Validated] SMARCA4 Rabbit Polyclonal Antibody
Product SKU:CAB0887
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Mutations in this gene cause rhabdoid tumor predisposition syndrome type 2. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 30-130 of human SMARCA4 (NP_003063.2).
Sequence:

PSPGPSPGSAHSMMGPSPGPPSAGHPIPTQGPGGYPQDNMHQMHKPMESMHEKGMSDDPRYNQMKGMGMRSGGHAGMGPPPSPMDQHSQGYPSPLGGSEHA

Gene ID:6597
Swiss Prot:P51532
Synonyms:BAF190; BAF190A; BRG1; CSS4; MRD16; RTPS2; SNF2; SNF2L4; SNF2LB; SWI2; hSNF2b; SMARCA4
Calculated MW:181kDa/184kDa
Observed MW:180kDa
Reactivity:Human
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:20 - 1:50
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence 
Positive Samples:OVCAR3, HeLa
Cellular Location:Nucleus

Product Images

[KO Validated] SMARCA4 Rabbit Polyclonal Antibody (CAB0887)

Western blot analysis of extracts of various cell lines, using SMARCA4 antibody (CAB0887) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

[KO Validated] SMARCA4 Rabbit Polyclonal Antibody (CAB0887)

Western blot analysis of extracts from normal (control) and SMARCA4 knockout (KO) 293T cells, using SMARCA4 antibody (CAB0887) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

[KO Validated] SMARCA4 Rabbit Polyclonal Antibody (CAB0887)

Immunohistochemistry of paraffin-embedded human colon using SMARCA4 antibody (CAB0887) at dilution of 1:100 (40x lens).

[KO Validated] SMARCA4 Rabbit Polyclonal Antibody (CAB0887)

Immunohistochemistry of paraffin-embedded human colon carcinoma using SMARCA4 antibody (CAB0887) at dilution of 1:100 (40x lens).

[KO Validated] SMARCA4 Rabbit Polyclonal Antibody (CAB0887)

Immunofluorescence analysis of HeLa cells using SMARCA4 antibody (CAB0887).

Uniprot Information

UniProt Protein Function:SMARCA4: a member of the SWI/SNF nucleosome remodeling complex with ATP-dependent DNA helicase activity. SWI/SNF complexes are required for mammalian development and are mutated in ~20% of all human primary tumors. Mutated in 35% (13/37) of NSCLC and 5% (1/19) of SCLC human lung cancer cell lines. A component of the CREST-BRG1 complex, a multiprotein complex that regulates promoter activation by orchestrating a calcium-dependent release of a repressor complex and a recruitment of an activator complex. Belongs to the neural progenitor-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). Component of the BAF53 complex which acetylates histone H4 and H2A within nucleosomes. Transcriptional coactivator of nuclear hormone receptors. Acts as a corepressor of ZEB1 to regulate E-cadherin transcription, and is required for induction of epithelial-mesenchymal transition (EMT) by ZEB1. Can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. SMARCA4, in consort with ZEB1, represses the transcription of E-cadherin and promotes the epithelial-to-mesenchymal transisition (EMT). SMARCA4 is required for stem cell maintenance in the mouse intestinal epithelium. Its loss inhibits aberrant Wnt-signalling and prevents tumorigenesis in the mouse small intestine. SMARCA4 mutations are the cause of a familial cancer syndrome predisposing to renal or extrarenal malignant rhabdoid tumors and to a variety of tumors of the central nervous system, including choroid plexus carcinoma, medulloblastoma, and central primitive neuroectodermal tumors. Rhabdoid tumors are the most aggressive and lethal malignancies occurring in early childhood. Belongs to the SNF2/RAD54 helicase family. The human protein includes 5 isoforms produced by alternative splicing.
UniProt Protein Details:

Protein type:Tumor suppressor; Transcription, coactivator/corepressor; EC 3.6.1.-; Helicase; EC 3.6.4.-; Nuclear receptor co-regulator; Cell cycle regulation

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleoplasm; heterochromatin; SWI/SNF complex; extracellular space; protein complex; membrane; perichromatin fibrils; nuclear chromatin; nucleolus; nucleus

Molecular Function:DNA-dependent ATPase activity; protein binding; nucleosomal DNA binding; androgen receptor binding; Tat protein binding; p53 binding; transcription coactivator activity; protein N-terminus binding; transcription corepressor activity; helicase activity; ATP binding

Biological Process: extracellular matrix organization and biogenesis; establishment and/or maintenance of chromatin architecture; glial cell fate determination; positive regulation of transcription, DNA-dependent; negative regulation of transcription from RNA polymerase II promoter, mitotic; cell morphogenesis; negative regulation of transcription from RNA polymerase II promoter; embryonic hindlimb morphogenesis; embryonic organ morphogenesis; epidermis morphogenesis; blastocyst hatching; forebrain development; blastocyst growth; vasculogenesis; positive regulation of Wnt receptor signaling pathway; positive regulation of DNA binding; hindbrain development; transcription, DNA-dependent; stem cell maintenance; liver development; keratinocyte differentiation; chromatin remodeling; regulation of transcription from RNA polymerase II promoter; cytosine methylation within a CG sequence; nucleosome disassembly; methylation-dependent chromatin silencing; ATP-dependent chromatin remodeling; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; negative regulation of cell growth; negative regulation of transcription, DNA-dependent

Disease: Mental Retardation, Autosomal Dominant 16; Rhabdoid Tumor Predisposition Syndrome 2

NCBI Summary:The protein encoded by this gene is a member of the SWI/SNF family of proteins and is similar to the brahma protein of Drosophila. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein is part of the large ATP-dependent chromatin remodeling complex SNF/SWI, which is required for transcriptional activation of genes normally repressed by chromatin. In addition, this protein can bind BRCA1, as well as regulate the expression of the tumorigenic protein CD44. Mutations in this gene cause rhabdoid tumor predisposition syndrome type 2. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2012]
UniProt Code:P51532
NCBI GenInfo Identifier:116242792
NCBI Gene ID:6597
NCBI Accession:P51532.2
UniProt Secondary Accession:P51532,O95052, Q9HBD3, B1A8Z4, B1A8Z5, B1A8Z6, B1A8Z7 E9PBR8,
UniProt Related Accession:P51532
Molecular Weight:1647
NCBI Full Name:Transcription activator BRG1
NCBI Synonym Full Names:SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
NCBI Official Symbol:SMARCA4 
NCBI Official Synonym Symbols:BRG1; SNF2; SWI2; MRD16; RTPS2; BAF190; SNF2L4; SNF2LB; hSNF2b; BAF190A 
NCBI Protein Information:transcription activator BRG1; SNF2-beta; SNF2-like 4; protein BRG-1; nuclear protein GRB1; brahma protein-like 1; BRM/SWI2-related gene 1; homeotic gene regulator; protein brahma homolog 1; BRG1-associated factor 190A; sucrose nonfermenting-like 4; ATP-dependent helicase SMARCA4; mitotic growth and transcription activator; global transcription activator homologous sequence
UniProt Protein Name:Transcription activator BRG1
UniProt Synonym Protein Names:ATP-dependent helicase SMARCA4; BRG1-associated factor 190A; BAF190A; Mitotic growth and transcription activator; Protein BRG-1; Protein brahma homolog 1; SNF2-beta; SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 4
Protein Family:Transcription activator
UniProt Gene Name:SMARCA4 
UniProt Entry Name:SMCA4_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose