LPIN1 Polyclonal Antibody (CAB8486)

(No reviews yet) Write a Review
SKU:
CAB8486
€99 - €249

Description

Technical Manual

LPIN1 Rabbit Polyclonal Antibody

Product Name:LPIN1 Rabbit Polyclonal Antibody
Product SKU:CAB8486
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a magnesium-ion-dependent phosphatidic acid phosphohydrolase enzyme that catalyzes the penultimate step in triglyceride synthesis including the dephosphorylation of phosphatidic acid to yield diacylglycerol. Expression of this gene is required for adipocyte differentiation and it also functions as a nuclear transcriptional coactivator with some peroxisome proliferator-activated receptors to modulate expression of other genes involved in lipid metabolism. Mutations in this gene are associated with metabolic syndrome, type 2 diabetes, and autosomal recessive acute recurrent myoglobinuria (ARARM). This gene is also a candidate for several human lipodystrophy syndromes. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their full-length structures have not been determined.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 741-890 of human LPIN1 (NP_663731.1).
Sequence:

NERGTVLPQGPLLLSPSSLFSALHREVIEKKPEKFKVQCLTDIKNLFFPNTEPFYAAFGNRPADVYSYKQVGVSLNRIFTVNPKGELVQEHAKTNISSYVRLCEVVDHVFPLLKRSHSSDFPCSDTFSNFTFWREPLPPFENQDIHSASA

Gene ID:23175
Swiss Prot:Q14693
Synonyms:LPIN1; PAP1; lipin 1
Calculated MW:50kDa/98kDa/99-107kDa
Observed MW:113kDa
Reactivity:Rat
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:Rat skeletal muscle
Cellular Location:Cytoplasm, Endoplasmic reticulum membrane, Nucleus membrane, cytosol

Product Images

LPIN1 Polyclonal Antibody (CAB8486)

Western blot analysis of extracts of rat skeletal muscle, using LPIN1 antibody (CAB8486) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

Uniprot Information

UniProt Protein Function:LPIN1: Plays important roles in controlling the metabolism of fatty acids at differents levels. Acts as a magnesium-dependent phosphatidate phosphatase enzyme which catalyzes the conversion of phosphatidic acid to diacylglycerol during triglyceride, phosphatidylcholine and phosphatidylethanolamine biosynthesis in the reticulum endoplasmic membrane. Acts also as a nuclear transcriptional coactivator for PPARGC1A/PPARA to modulate lipid metabolism gene expression. Is involved in adipocyte differentiation. May also be involved in mitochondrial fission by converting phosphatidic acid to diacylglycerol. Interacts (via LXXIL motif) with PPARA. Interacts with PPARGC1A. Interaction with PPARA and PPARGC1A leads to the formation of a complex that modulates gene transcription. Interacts with MEF2C. Specifically expressed in skeletal muscle. Also abundant in adipose tissue. Lower levels in some portions of the digestive tract. Inhibited by N-ethylmaleimide. Belongs to the lipin family.
UniProt Protein Details:

Protein type:Phosphatase, lipid; EC 3.1.3.4

Chromosomal Location of Human Ortholog: 2p25.1

Cellular Component: nucleoplasm; endoplasmic reticulum membrane; transcription factor complex; mitochondrial outer membrane; nuclear membrane; cytoplasm; nuclear envelope; nucleus; cytosol

Molecular Function:peroxisome proliferator activated receptor binding; phosphatidate phosphatase activity; histone deacetylase binding; transcription coactivator activity

Biological Process: mitochondrial fission; organ regeneration; transcription, DNA-dependent; regulation of fat cell differentiation; phosphatidylethanolamine biosynthetic process; glycerophospholipid biosynthetic process; mitotic nuclear envelope disassembly; triacylglycerol biosynthetic process; negative regulation of transcription from RNA polymerase II promoter; fatty acid catabolic process; cellular lipid metabolic process; positive regulation of histone deacetylation; cellular response to insulin stimulus; dephosphorylation; phospholipid metabolic process; actin cytoskeleton reorganization; phosphatidylcholine biosynthetic process; ruffle organization and biogenesis; positive regulation of transcription from RNA polymerase II promoter; mitotic cell cycle; triacylglycerol mobilization

Disease: Myoglobinuria, Acute Recurrent, Autosomal Recessive

NCBI Summary:This gene encodes a magnesium-ion-dependent phosphatidic acid phosphohydrolase enzyme that catalyzes the penultimate step in triglyceride synthesis including the dephosphorylation of phosphatidic acid to yield diacylglycerol. Expression of this gene is required for adipocyte differentiation and it also functions as a nuclear transcriptional coactivator with some peroxisome proliferator-activated receptors to modulate expression of other genes involved in lipid metabolism. Mutations in this gene are associated with metabolic syndrome, type 2 diabetes, and autosomal recessive acute recurrent myoglobinuria (ARARM). This gene is also a candidate for several human lipodystrophy syndromes. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional splice variants have been described but their full-length structures have not been determined. [provided by RefSeq, May 2012]
UniProt Code:Q14693
NCBI GenInfo Identifier:387528011
NCBI Gene ID:23175
NCBI Accession:NP_001248356.1
UniProt Secondary Accession:Q14693,Q53T25, A8MU38, B4DET9, B4DGS4, B4DGZ6, B5MC18 B7Z858, D6W506, E7ESE7, F5GY24,
UniProt Related Accession:Q14693
Molecular Weight:98,664 Da
NCBI Full Name:phosphatidate phosphatase LPIN1 isoform 2
NCBI Synonym Full Names:lipin 1
NCBI Official Symbol:LPIN1 
NCBI Official Synonym Symbols:PAP1 
NCBI Protein Information:phosphatidate phosphatase LPIN1; lipin-1
UniProt Protein Name:Phosphatidate phosphatase LPIN1
UniProt Synonym Protein Names:Lipin-1
Protein Family:Phosphatidate phosphatase
UniProt Gene Name:LPIN1 
UniProt Entry Name:LPIN1_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Application:
WB
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
View AllClose

0 Reviews

View AllClose