Anti-MMP16 Antibody (CAB10409)

SKU:
CAB10409
  • Cell Biology Antibodies 1 Anti-MMP16 Antibody CAB10409
  • Cell Biology Antibodies 1 Anti-MMP16 Antibody CAB10409
  • Cell Biology Antibodies 1 Anti-MMP16 Antibody CAB10409
  • Cell Biology Antibodies 1 Anti-MMP16 Antibody CAB10409
  • Cell Biology Antibodies 1 Anti-MMP16 Antibody CAB10409
€99 - €249

Description

Technical Manual

Anti-MMP16 Antibody

Product Name:Anti-MMP16 Antibody
Product SKU:CAB10409
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein activates MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 290-565 of human MMP16 (NP_005932.2).
Sequence:

YGPPDKIPPPTRPLPTVPPHRSIPPADPRKNDRPKPPRPPTGRPSYPGAKPNICDGNFNTLAILRREMFVFKDQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKYWVFKDTTLQPGYPHDLITLGSGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEEMKTMDPGYPKPITVWKGIPESPQGAFVHKENGFTYFYKGKEYWKFNNQILKVEPGYPRSILKDFMGCDGPTDRVKEGHSPPDDVDIVIKLDNTASTVKAI

Gene ID:4325
Swiss Prot:P51512
Synonyms:MMP16; C8orf57; MMP-X2; MT-MMP2; MT-MMP3; MT3-MMP
Calculated MW:52kDa/69kDa
Observed MW:60kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence
Positive Samples:U-87MG, HT-29, MCF7, HT-1080, Mouse brain, Rat brain
Cellular Location:Cell membrane, Cell surface, Extracellular side, Secreted, Single-pass type I membrane protein, extracellular matrix, extracellular space

Product Images

Anti-MMP16 Antibody (CAB10409)

Western blot analysis of extracts of various cell lines, using MMP16 antibody (CAB10409) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.

Anti-MMP16 Antibody (CAB10409)

Immunohistochemistry of paraffin-embedded human lung cancer using MMP16 antibody (CAB10409) at dilution of 1:100 (40x lens).

Anti-MMP16 Antibody (CAB10409)

Immunohistochemistry of paraffin-embedded human colon carcinoma using MMP16 antibody (CAB10409) at dilution of 1:100 (40x lens).

Anti-MMP16 Antibody (CAB10409)

Immunohistochemistry of paraffin-embedded human breast using MMP16 antibody (CAB10409) at dilution of 1:100 (40x lens).

Anti-MMP16 Antibody (CAB10409)

Immunohistochemistry of paraffin-embedded human breast cancer using MMP16 antibody (CAB10409) at dilution of 1:100 (40x lens).

Uniprot Information

UniProt Protein Function:MMP16: Endopeptidase that degrades various components of the extracellular matrix, such as collagen type III and fibronectin. Activates progelatinase A. Involved in the matrix remodeling of blood vessels. Isoform short cleaves fibronectin and also collagen type III, but at lower rate. It has no effect on type I, II, IV and V collagen. However, upon interaction with CSPG4, it may be involved in degradation and invasion of type I collagen by melanoma cells. Belongs to the peptidase M10A family. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:EC 3.4.24.-; Membrane protein, integral; Protease

Chromosomal Location of Human Ortholog: 8q21.3

Cellular Component: Golgi lumen; integral to plasma membrane; plasma membrane

Molecular Function:enzyme activator activity; metalloendopeptidase activity; zinc ion binding

Biological Process: extracellular matrix disassembly; protein metabolic process; protein processing; proteolysis

NCBI Summary:Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The encoded protein activates MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16. [provided by RefSeq, Oct 2010]
UniProt Code:P51512
NCBI GenInfo Identifier:3041669
NCBI Gene ID:4325
NCBI Accession:P51512.2
UniProt Secondary Accession:P51512,Q14824, Q52H48, B2RAN7,
UniProt Related Accession:P51512
Molecular Weight:Observed MW: 60kDaCalculated MW: 52kDa/69kDa
NCBI Full Name:Matrix metalloproteinase-16
NCBI Synonym Full Names:matrix metallopeptidase 16
NCBI Official Symbol:MMP16
NCBI Official Synonym Symbols:MMP-X2; C8orf57; MT-MMP2; MT-MMP3; MT3-MMP
NCBI Protein Information:matrix metalloproteinase-16
UniProt Protein Name:Matrix metalloproteinase-16
UniProt Synonym Protein Names:MMP-X2; Membrane-type matrix metalloproteinase 3; MT-MMP 3; MTMMP3; Membrane-type-3 matrix metalloproteinase; MT3-MMP; MT3MMP
Protein Family:Matrix metalloproteinase
UniProt Gene Name:MMP16
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose