Anti-LMAN1 Antibody (CAB10440)

SKU:
CAB10440
  • Cell Biology Antibodies 1 Anti-LMAN1 Antibody CAB10440
  • Cell Biology Antibodies 1 Anti-LMAN1 Antibody CAB10440
  • Cell Biology Antibodies 1 Anti-LMAN1 Antibody CAB10440
  • Cell Biology Antibodies 1 Anti-LMAN1 Antibody CAB10440
€99 - €249

Description

Technical Manual

Anti-LMAN1 Antibody

Product Name:Anti-LMAN1 Antibody
Product SKU:CAB10440
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

The protein encoded by this gene is a membrane mannose-specific lectin that cycles between the endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment, and cis-Golgi, functioning as a cargo receptor for glycoprotein transport. The protein has an N-terminal signal sequence, a calcium-dependent and pH-sensitive carbohydrate recognition domain, a stalk region that functions in oligomerization, a transmembrane domain, and a short cytoplasmic domain required for organelle targeting. Allelic variants of this gene are associated with the autosomal recessive disorder combined factor V-factor VIII deficiency.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 270-480 of human LMAN1 (NP_005561.1).
Sequence:

PGKEPPTPDKEISEKEKEKYQEEFEHFQQELDKKKEEFQKGHPDLQGQPAEEIFESVGDRELRQVFEGQNRIHLEIKQLNRQLDMILDEQRRYVSSLTEEISKRGAGMPGQHGQITQQELDTVVKTQHEILRQVNEMKNSMSETVRLVSGMQHPGSAGGVYETTQHFIDIKEHLHIVKRDIDNLVQRNMPSNEKPKCPELPPFPSCLSTVH

Gene ID:3998
Swiss Prot:P49257
Synonyms:LMAN1; ERGIC-53; ERGIC53; F5F8D; FMFD1; MCFD1; MR60; gp58
Calculated MW:57kDa
Observed MW:55kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence
Positive Samples:BT-474, LO2, U-251MG
Cellular Location:Endoplasmic reticulum membrane, Endoplasmic reticulum-Golgi intermediate compartment membrane, Golgi apparatus membrane, Single-pass membrane protein, Single-pass type I membrane protein

Product Images

Anti-LMAN1 Antibody (CAB10440)

Western blot analysis of extracts of various cell lines, using LMAN1 antibody (CAB10440) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s.

Anti-LMAN1 Antibody (CAB10440)

Immunofluorescence analysis of C6 cells using LMAN1 Rabbit pAb (CAB10440) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Anti-LMAN1 Antibody (CAB10440)

Immunofluorescence analysis of NIH-3T3 cells using LMAN1 Rabbit pAb (CAB10440) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Anti-LMAN1 Antibody (CAB10440)

Immunofluorescence analysis of U-2 OS cells using LMAN1 Rabbit pAb (CAB10440) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:LMAN1: Mannose-specific lectin. May recognize sugar residues of glycoproteins, glycolipids, or glycosylphosphatidyl inositol anchors and may be involved in the sorting or recycling of proteins, lipids, or both. The LMAN1-MCFD2 complex forms a specific cargo receptor for the ER-to-Golgi transport of selected proteins. Defects in LMAN1 are THE cause of factor V and factor VIII combined deficiency type 1 (F5F8D1); also known as multiple coagulation factor deficiency I (MCFD1). F5F8D1 is an autosomal recessive blood coagulation disorder characterized by bleeding symptoms similar to those in hemophilia or parahemophilia, that are caused by single deficiency of FV or FVIII, respectively. The most common symptoms are epistaxis, menorrhagia, and excessive bleeding during or after trauma. Plasma levels of coagulation factors V and VIII are in the range of 5 to 30% of normal.
UniProt Protein Details:

Protein type:Membrane protein, integral

Chromosomal Location of Human Ortholog: 18q21.32

Cellular Component: endoplasmic reticulum membrane; ER-Golgi intermediate compartment; ER-Golgi intermediate compartment membrane; membrane

Molecular Function:protein binding; unfolded protein binding

Biological Process: blood coagulation; COPII coating of Golgi vesicle; ER to Golgi vesicle-mediated transport; Golgi organization and biogenesis; protein amino acid N-linked glycosylation via asparagine; protein exit from endoplasmic reticulum; protein folding

Disease: Factor V And Factor Viii, Combined Deficiency Of, 1

NCBI Summary:The protein encoded by this gene is a membrane mannose-specific lectin that cycles between the endoplasmic reticulum, endoplasmic reticulum-Golgi intermediate compartment, and cis-Golgi, functioning as a cargo receptor for glycoprotein transport. The protein has an N-terminal signal sequence, a calcium-dependent and pH-sensitive carbohydrate recognition domain, a stalk region that functions in oligomerization, a transmembrane domain, and a short cytoplasmic domain required for organelle targeting. Allelic variants of this gene are associated with the autosomal recessive disorder combined factor V-factor VIII deficiency. [provided by RefSeq, Jul 2015]
UniProt Code:P49257
NCBI GenInfo Identifier:22261801
NCBI Gene ID:3998
NCBI Accession:P49257.2
UniProt Secondary Accession:P49257,Q12895, Q8N5I7, Q9UQG1, Q9UQG2, Q9UQG3, Q9UQG4 Q9UQG5, Q9UQG6, Q9UQG7, Q9UQG8, Q9UQG9,
UniProt Related Accession:P49257
Molecular Weight:58kDa
NCBI Full Name:Protein ERGIC-53
NCBI Synonym Full Names:lectin, mannose binding 1
NCBI Official Symbol:LMAN1
NCBI Official Synonym Symbols:MR60; gp58; F5F8D; FMFD1; MCFD1; ERGIC53; ERGIC-53
NCBI Protein Information:protein ERGIC-53
UniProt Protein Name:Protein ERGIC-53
UniProt Synonym Protein Names:ER-Golgi intermediate compartment 53 kDa protein; Gp58; Intracellular mannose-specific lectin MR60; Lectin mannose-binding 1
Protein Family:Protein
UniProt Gene Name:LMAN1
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose