Anti-RAB34 Antibody (CAB10332)

SKU:
CAB10332
€99 - €249

Description

Technical Manual

Anti-RAB34 Antibody

Product Name:Anti-RAB34 Antibody
Product SKU:CAB10332
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a protein belonging to the RAB family of proteins, which are small GTPases involved in protein transport. This family member is a Golgi-bound member of the secretory pathway that is involved in the repositioning of lysosomes and the activation of macropinocytosis. Alternative splicing of this gene results in multiple transcript variants. An alternatively spliced transcript variant produces the nine-amino acid residue-repeats (NARR) protein, which is a functionally distinct nucleolar protein resulting from a different reading frame.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-259 of human RAB34 (NP_114140.4).
Sequence:

MNILAPVRRDRVLAELPQCLRKEAALHGHKDFHPRVTCACQEHRTGTVGFKISKVIVVGDLSVGKTCLINRFCKDTFDKNYKATIGVDFEMERFEVLGIPFSLQLWDTAGQERFKCIASTYYRGAQAIIIVFNLNDVASLEHTKQWLADALKENDPSSVLLFLVGSKKDLSTPAQYALMEKDALQVAQEMKAEYWAVSSLTGENVREFFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTCCP

Gene ID:83871
Swiss Prot:P0DI83/Q9BZG1
Synonyms:RAB34; NARR; RAB39; RAH
Calculated MW:21kDa/28kDa/29kDa
Observed MW:29kDa
Reactivity:Human, Mouse, Rat
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:Mouse lung, Mouse brain, Mouse kidney, Mouse testis
Cellular Location:Nucleus, nucleolus

Product Images

Anti-RAB34 Antibody (CAB10332)

Western blot analysis of extracts of various cell lines, using RAB34 antibody (CAB10332) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose