Anti-SLC2A13 Antibody (CAB9993)

SKU:
CAB9993
  • Signal Transduction Antibodies 3 Anti-SLC2A13 Antibody CAB9993
  • Signal Transduction Antibodies 3 Anti-SLC2A13 Antibody CAB9993
  • Signal Transduction Antibodies 3 Anti-SLC2A13 Antibody CAB9993
  • Signal Transduction Antibodies 3 Anti-SLC2A13 Antibody CAB9993
€99 - €249

Description

Technical Manual

Anti-SLC2A13 Antibody

Product Name:Anti-SLC2A13 Antibody
Product SKU:CAB9993
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 564-648 of human SLC2A13 (NP_443117.3).
Sequence:

LHTAEYLTYYGAFFLYAGFAAVGLLFIYGCLPETKGKKLEEIESLFDNRLCTCGTSDSDEGRYIEYIRVKGSNYHLSDNDASDVE

Gene ID:114134
Swiss Prot:Q96QE2
Synonyms:SLC2A13; HMIT
Calculated MW:70kDa
Observed MW:73kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC
Recommended Dilution:WB 1:1000 - 1:4000 IHC 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry 
Positive Samples:HeLa, SH-SY5Y, HepG2, NCI-H460, HT-1080, K-562, Mouse kidney, Mouse pancreas, Rat kidney
Cellular Location:Membrane, Multi-pass membrane protein

Product Images

Anti-SLC2A13 Polyclonal Antibody (CAB9993)

Western blot analysis of extracts of various cell lines, using SLC2A13 antibody (CAB9993) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.

Anti-SLC2A13 Polyclonal Antibody (CAB9993)

Immunohistochemistry of paraffin-embedded human gastric cancer using SLC2A13 antibody (CAB9993) at dilution of 1:100 (40x lens).

Anti-SLC2A13 Polyclonal Antibody (CAB9993)

Immunohistochemistry of paraffin-embedded rat brain using SLC2A13 antibody (CAB9993) at dilution of 1:100 (40x lens).

Anti-SLC2A13 Polyclonal Antibody (CAB9993)

Immunohistochemistry of paraffin-embedded mouse spinal cord using SLC2A13 antibody (CAB9993) at dilution of 1:100 (40x lens).

Uniprot Information

UniProt Protein Function:GLUT13: an integral membrane facilitative glucose transporter. One of 13 members of the human equilibrative glucose transport protein family. Its mRNA is expressed mainly in the brain, especially the hippocampus, hypothalamus, cerebellum and brainstem. Expressed in both neurons and glial cells. It may play a key role in the control of myo-inositol metabolism in the brain. Low levels have been observed in white, brown and epididymal adipose tissues and in the kidney.
UniProt Protein Details:

Protein type:Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, SLC family

Chromosomal Location of Human Ortholog: 12q12

Cellular Component: integral to plasma membrane; plasma membrane

Molecular Function:glucose transmembrane transporter activity; myo-inositol:hydrogen symporter activity; sugar:hydrogen ion symporter activity

Biological Process: glucose import

UniProt Code:Q96QE2
NCBI GenInfo Identifier:294862502
NCBI Gene ID:114134
NCBI Accession:Q96QE2.3
UniProt Secondary Accession:Q96QE2,Q17S07,
UniProt Related Accession:Q96QE2
Molecular Weight:70,371 Da
NCBI Full Name:Proton myo-inositol cotransporter
NCBI Synonym Full Names:solute carrier family 2 member 13
NCBI Official Symbol:SLC2A13 
NCBI Official Synonym Symbols:HMIT 
NCBI Protein Information:proton myo-inositol cotransporter
UniProt Protein Name:Proton myo-inositol cotransporter
UniProt Synonym Protein Names:H(+)-myo-inositol symporter; Solute carrier family 2 member 13
Protein Family:Proton myo-inositol cotransporter
UniProt Gene Name:SLC2A13 
UniProt Entry Name:MYCT_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Application:
WB
Application:
IHC
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Research Area:
Signal Transduction
View AllClose