[KO Validated] SOX2 Rabbit Polyclonal Antibody (CAB0561)

(No reviews yet) Write a Review
SKU:
CAB0561
  • Western blot analysis of extracts of MCF7 cells, using SOX2 antibody (CAB0561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.
  • Western blot analysis of extracts of various cell lines, using SOX2 antibody (CAB0561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.
  • Western blot analysis of extracts from normal (control) and SOX2 knockout (KO) 293T cells, using SOX2 antibody (CAB0561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.
  • Immunohistochemistry of paraffin-embedded mouse embryos using [KO Validated] SOX2 Rabbit pAb (CAB0561) at dilution of 1:100 (40x lens).
  • Immunohistochemistry of paraffin-embedded human esophageal using [KO Validated] SOX2 Rabbit pAb (CAB0561) at dilution of 1:100 (40x lens).
€99 - €249

Description

Technical Manual

[KO Validated] SOX2 Rabbit Polyclonal Antibody

Product Name:[KO Validated] SOX2 Rabbit Polyclonal Antibody
Product SKU:CAB0561
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT).

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human SOX2 (NP_003097.1).
Sequence:

MYNMMETELKPPGPQQTSGGGGGNSTAAAAGGNQKNSPDRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRKTKTLMKKDKYTLPGGLLAPGGNSMA

Gene ID:6657
Swiss Prot:P48431
Synonyms:ANOP3; MCOPS3; SOX2; SRY-box 2
Calculated MW:34kDa
Observed MW:35KDa
Reactivity:Human, Mouse, Rat
Application:WB IHC IF IP
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation 
Positive Samples:293T, MCF7, Mouse lung, Rat brain
Cellular Location:Nucleus

Product Images

[KO Validated] SOX2 Rabbit Polyclonal Antibody (CAB0561)

Western blot analysis of extracts of MCF7 cells, using SOX2 antibody (CAB0561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.

[KO Validated] SOX2 Rabbit Polyclonal Antibody (CAB0561)

Western blot analysis of extracts of various cell lines, using SOX2 antibody (CAB0561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s.

[KO Validated] SOX2 Rabbit Polyclonal Antibody (CAB0561)

Western blot analysis of extracts from normal (control) and SOX2 knockout (KO) 293T cells, using SOX2 antibody (CAB0561) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s.

[KO Validated] SOX2 Rabbit Polyclonal Antibody (CAB0561)

Immunohistochemistry of paraffin-embedded mouse embryos using [KO Validated] SOX2 Rabbit pAb (CAB0561) at dilution of 1:100 (40x lens).

[KO Validated] SOX2 Rabbit Polyclonal Antibody (CAB0561)

Immunohistochemistry of paraffin-embedded human esophageal using [KO Validated] SOX2 Rabbit pAb (CAB0561) at dilution of 1:100 (40x lens).

Uniprot Information

UniProt Protein Function:SOX2: Transcription factor that forms a trimeric complex with OCT4 on DNA and controls the expression of a number of genes involved in embryonic development such as YES1, FGF4, UTF1 and ZFP206. Critical for early embryogenesis and for embryonic stem cell pluripotency. May function as a switch in neuronal development. Downstream SRRT target that mediates the promotion of neural stem cell self-renewal. Keeps neural cells undifferentiated by counteracting the activity of proneural proteins and suppresses neuronal differentiation. Interacts with ZSCAN10. Interacts with SOX3 and FGFR1.
UniProt Protein Details:

Protein type:Cell development/differentiation; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 3q26.33

Cellular Component: cytoplasm; cytosol; nucleoplasm; nucleus; transcription factor complex

Molecular Function:DNA binding; miRNA binding; protein binding; sequence-specific DNA binding; transcription factor activity

Biological Process: cell cycle arrest; endodermal cell fate specification; eye development; forebrain development; inner ear development; negative regulation of epithelial cell proliferation; negative regulation of neuron differentiation; negative regulation of transcription from RNA polymerase II promoter; osteoblast differentiation; pituitary gland development; positive regulation of MAPKKK cascade; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-dependent; regulation of caspase activity; regulation of gene expression; regulation of transcription, DNA-dependent; response to wounding; somatic stem cell maintenance

Disease: Microphthalmia, Syndromic 3; Tracheoesophageal Fistula With Or Without Esophageal Atresia

NCBI Summary:This intronless gene encodes a member of the SRY-related HMG-box (SOX) family of transcription factors involved in the regulation of embryonic development and in the determination of cell fate. The product of this gene is required for stem-cell maintenance in the central nervous system, and also regulates gene expression in the stomach. Mutations in this gene have been associated with optic nerve hypoplasia and with syndromic microphthalmia, a severe form of structural eye malformation. This gene lies within an intron of another gene called SOX2 overlapping transcript (SOX2OT). [provided by RefSeq, Jul 2008]
UniProt Code:P48431
NCBI GenInfo Identifier:1351091
NCBI Gene ID:6657
NCBI Accession:P48431.1
UniProt Secondary Accession:P48431,Q14537,
UniProt Related Accession:P48431
Molecular Weight:34kDa
NCBI Full Name:Transcription factor SOX-2
NCBI Synonym Full Names:SRY-box 2
NCBI Official Symbol:SOX2 
NCBI Official Synonym Symbols:ANOP3; MCOPS3 
NCBI Protein Information:transcription factor SOX-2
UniProt Protein Name:Transcription factor SOX-2
UniProt Gene Name:SOX2 
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose