[KO Validated] HINT1 Rabbit Polyclonal Antibody (CAB10221)

(No reviews yet) Write a Review
SKU:
CAB10221
  • Western blot analysis of extracts of various cell lines, using HINT1 antibody (CAB10221) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.
  • Western blot analysis of extracts from normal (control) and HINT1 knockout (KO) HeLa cells, using HINT1 antibody (CAB10221) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.
  • Immunofluorescence analysis of H9C2 cells using [KO Validated] HINT1 Rabbit pAb (CAB10221) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
  • Immunofluorescence analysis of L929 cells using [KO Validated] HINT1 Rabbit pAb (CAB10221) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
€129 - €349

Description

Technical Manual

[KO Validated] HINT1 Rabbit Polyclonal Antibody

Product Name:[KO Validated] HINT1 Rabbit Polyclonal Antibody
Product SKU:CAB10221
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a protein that hydrolyzes purine nucleotide phosphoramidates substrates, including AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif. This gene is considered a tumor suppressor gene. In addition, mutations in this gene can cause autosomal recessive neuromyotonia and axonal neuropathy. There are several related pseudogenes on chromosome 7. Several transcript variants have been observed.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-126 of human HINT1 (NP_005331.1).
Sequence:

MADEIAKAQVARPGGDTIFGKIIRKEIPAKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG

Gene ID:3094
Swiss Prot:P49773
Synonyms:HINT1; HINT; NMAN; PKCI-1; PRKCNH1
Calculated MW:13kDa
Observed MW:14kDa
Reactivity:Human, Mouse, Rat
Application:WB IF
Recommended Dilution:WB 1:1000 - 1:2000 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunofluorescence 
Positive Samples:22Rv1, HeLa, H460, K-562, Mouse kidney, Mouse liver, Rat kidney, Rat liver
Cellular Location:Cytoplasm, Nucleus

Product Images

[KO Validated] HINT1 Rabbit Polyclonal Antibody (CAB10221)

Western blot analysis of extracts of various cell lines, using HINT1 antibody (CAB10221) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.

[KO Validated] HINT1 Rabbit Polyclonal Antibody (CAB10221)

Western blot analysis of extracts from normal (control) and HINT1 knockout (KO) HeLa cells, using HINT1 antibody (CAB10221) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.

[KO Validated] HINT1 Rabbit Polyclonal Antibody (CAB10221)

Immunofluorescence analysis of H9C2 cells using [KO Validated] HINT1 Rabbit pAb (CAB10221) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

[KO Validated] HINT1 Rabbit Polyclonal Antibody (CAB10221)

Immunofluorescence analysis of L929 cells using [KO Validated] HINT1 Rabbit pAb (CAB10221) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:HINT1: Hydrolyzes adenosine 5'-monophosphoramidate substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha- acetyl lysine methyl ester and AMP-NH2. Belongs to the HINT family.
UniProt Protein Details:

Protein type:Hydrolase; EC 3.-.-.-; Cytoskeletal

Chromosomal Location of Human Ortholog: 5q31.2

Cellular Component: cytoskeleton; histone deacetylase complex; cytoplasm; plasma membrane; nucleus

Molecular Function:protein kinase C binding; hydrolase activity; nucleotide binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; purine ribonucleotide catabolic process; signal transduction

Disease: Neuromyotonia And Axonal Neuropathy, Autosomal Recessive

NCBI Summary:The protein encoded by this gene can hydrolyze substrates such as AMP-morpholidate, AMP-N-alanine methyl ester, AMP-alpha-acetyl lysine methyl ester, and AMP-NH2. The encoded protein interacts with these substrates via a histidine triad motif, which is part of the loop that binds to the substrate. This gene has been found to be a tumor suppressing gene. Several transcript variants, but only one of them protein-coding, have been found for this gene. [provided by RefSeq, Dec 2012]
UniProt Code:P49773
NCBI GenInfo Identifier:1708543
NCBI Gene ID:3094
NCBI Accession:P49773.2
UniProt Secondary Accession:P49773,Q9H5W8,
UniProt Related Accession:P49773
Molecular Weight:126
NCBI Full Name:Histidine triad nucleotide-binding protein 1
NCBI Synonym Full Names:histidine triad nucleotide binding protein 1
NCBI Official Symbol:HINT1 
NCBI Official Synonym Symbols:HINT; NMAN; PKCI-1; PRKCNH1 
NCBI Protein Information:histidine triad nucleotide-binding protein 1; protein kinase C inhibitor 1; adenosine 5'-monophosphoramidase; protein kinase C-interacting protein 1
UniProt Protein Name:Histidine triad nucleotide-binding protein 1
UniProt Synonym Protein Names:Adenosine 5'-monophosphoramidase; Protein kinase C inhibitor 1; Protein kinase C-interacting protein 1; PKCI-1
Protein Family:Adenylylsulfatase
UniProt Gene Name:HINT1 
UniProt Entry Name:HINT1_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose