ACSL1 Rabbit Polyclonal Antibody (CAB17482)

(No reviews yet) Write a Review
SKU:
CAB17482
€99 - €249

Description

Technical Manual

ACSL1 Rabbit Polyclonal Antibody

Product Name:ACSL1 Rabbit Polyclonal Antibody
Product SKU:CAB17482
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 46-275 of human ACSL1 (NP_001273637.1).
Sequence:

TRPKPLKPPCDLSMQSVEVAGSGGARRSALLDSDEPLVYFYDDVTTLYEGFQRGIQVSNNGPCLGSRKPDQPYEWLSYKQVAELSECIGSALIQKGFKTAPDQFIGIFAQNRPEWVIIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICF

Gene ID:2180
Swiss Prot:P33121
Synonyms:ACS1; FACL1; FACL2; LACS; LACS1; LACS2; ACSL1
Calculated MW:76kDa/77kDa
Observed MW:Refer to figures
Reactivity:Human, Mouse, Rat
Application:WB IF
Recommended Dilution:WB 1:500 - 1:2000 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunofluorescence 
Positive Samples:
Cellular Location:

Uniprot Information

UniProt Protein Function:ACSL1: Activation of long-chain fatty acids for both synthesis of cellular lipids, and degradation via beta-oxidation. Preferentially uses palmitoleate, oleate and linoleate. Highly expressed in liver, heart, skeletal muscle, kidney and erythroid cells, and to a lesser extent in brain, lung, placenta and pancreas. Belongs to the ATP-dependent AMP-binding enzyme family. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Lipid Metabolism - fatty acid; Ligase; Membrane protein, integral; EC 6.2.1.3

Chromosomal Location of Human Ortholog: 4q35.1

Cellular Component: peroxisomal membrane; mitochondrial outer membrane; endoplasmic reticulum membrane; mitochondrion; membrane; plasma membrane; integral to membrane

Molecular Function:ATP binding; long-chain-fatty-acid-CoA ligase activity

Biological Process: response to drug; response to oleate; unsaturated fatty acid metabolic process; lipid biosynthetic process; linoleic acid metabolic process; adiponectin-mediated signaling pathway; triacylglycerol biosynthetic process; cellular lipid metabolic process; long-chain fatty acid metabolic process; response to organic cyclic substance; response to nutrient; xenobiotic catabolic process

NCBI Summary:The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]
UniProt Code:P33121
NCBI GenInfo Identifier:417241
NCBI Gene ID:2180
NCBI Accession:P33121.1
UniProt Related Accession:P33121
Molecular Weight:
NCBI Full Name:Long-chain-fatty-acid--CoA ligase 1
NCBI Synonym Full Names:acyl-CoA synthetase long chain family member 1
NCBI Official Symbol:ACSL1 
NCBI Official Synonym Symbols:ACS1; LACS; FACL1; FACL2; LACS1; LACS2 
NCBI Protein Information:long-chain-fatty-acid--CoA ligase 1
UniProt Protein Name:Long-chain-fatty-acid--CoA ligase 1
UniProt Synonym Protein Names:Acyl-CoA synthetase 1; ACS1; Long-chain acyl-CoA synthetase 1; LACS 1; Long-chain acyl-CoA synthetase 2; LACS 2; Long-chain fatty acid-CoA ligase 2; Palmitoyl-CoA ligase 1; Palmitoyl-CoA ligase 2
Protein Family:Long-chain-fatty-acid--CoA ligase
UniProt Gene Name:ACSL1 
UniProt Entry Name:ACSL1_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose