Anti-GNA14 Antibody (CAB10405)

SKU:
CAB10405
  • Cell Biology Antibodies 1 Anti-GNA14 Antibody CAB10405
  • Cell Biology Antibodies 1 Anti-GNA14 Antibody CAB10405
€99 - €249

Description

Technical Manual

Anti-GNA14 Antibody

Product Name:Anti-GNA14 Antibody
Product SKU:CAB10405
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 40-350 of human GNA14 (NP_004288.1).
Sequence:

LLGTGESGKSTFIKQMRIIHGSGYSDEDRKGFTKLVYQNIFTAMQAMIRAMDTLRIQYVCEQNKENAQIIREVEVDKVSMLSREQVEAIKQLWQDPGIQECYDRRREYQLSDSAKYYLTDIDRIATPSFVPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFESVTSIIFLVALSEYDQVLAECDNENRMEESKALFKTIITYPWFLNSSVILFLNKKDLLEEKIMYSHLISYFPEYTGPKQDVRAARDFILKLYQDQNPDKEKVIYSHFTCATDTDNIRFVFAAVKDTILQLNLR

Gene ID:9630
Swiss Prot:O95837
Synonyms:GNA14
Calculated MW:41kDa
Observed MW:41kDa
Reactivity:Human, Mouse, Rat
Application:WB IF
Recommended Dilution:WB 1:500 - 1:2000 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunofluorescence 
Positive Samples:BxPC-3, 293T, Mouse stomach, Mouse lung, Rat kidney
Cellular Location:

Product Images

Anti-GNA14 Antibody (CAB10405)

Western blot analysis of extracts of various cell lines, using GNA14 antibody (CAB10405) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.

Anti-GNA14 Antibody (CAB10405)

Immunofluorescence analysis of NIH/3T3 cells using GNA14 antibody (CAB10405) at dilution of 1:100. Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:G-alpha 14: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Belongs to the G-alpha family. G(q) subfamily.
UniProt Protein Details:

Protein type:G protein, heterotrimeric alpha G(q); G protein; G protein, heterotrimeric

Chromosomal Location of Human Ortholog: 9q21

Cellular Component: heterotrimeric G-protein complex; plasma membrane

Molecular Function:GTPase activity; protein binding

Biological Process: dopamine receptor, phospholipase C activating pathway; platelet activation; signal transduction

NCBI Summary:This gene encodes a member of the guanine nucleotide-binding, or G protein family. G proteins are heterotrimers consisting of alpha, beta and gamma subunits. The encoded protein is a member of the alpha family of G proteins, more specifically the alpha q subfamily of G proteins. The encoded protein may play a role in pertussis-toxin resistant activation of phospholipase C-beta and its downstream effectors.[provided by RefSeq, Feb 2009]
UniProt Code:O95837
NCBI GenInfo Identifier:6016102
NCBI Gene ID:9630
NCBI Accession:O95837.1
UniProt Secondary Accession:O95837,B1ALW3,
UniProt Related Accession:O95837
Molecular Weight:41,571 Da
NCBI Full Name:Guanine nucleotide-binding protein subunit alpha-14
NCBI Synonym Full Names:G protein subunit alpha 14
NCBI Official Symbol:GNA14 
NCBI Protein Information:guanine nucleotide-binding protein subunit alpha-14
UniProt Protein Name:Guanine nucleotide-binding protein subunit alpha-14
Protein Family:Guanine nucleotide-binding protein
UniProt Gene Name:GNA14 
UniProt Entry Name:GNA14_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose