MBD2 Rabbit Polyclonal Antibody

(No reviews yet) Write a Review
SKU:
CAB11982
€99 - €249

Description

Technical Manual

MBD2 Rabbit Polyclonal Antibody

Product Name:MBD2 Rabbit Polyclonal Antibody
Product SKU:CAB11982
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. The protein encoded by this gene may function as a mediator of the biological consequences of the methylation signal. It is also reported that the this protein functions as a demethylase to activate transcription, as DNA methylation causes gene silencing. Two transcript variants encoding different isoforms have been found for this gene.

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human MBD2 (NP_003918.1).
Sequence:

IKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA

Gene ID:8932
Swiss Prot:Q9UBB5
Synonyms:MBD2; DMTase; NY-CO-41
Calculated MW:31kDa/43kDa
Observed MW:43kDa
Reactivity:Human, Mouse, Rat
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:mouse heart
Cellular Location:Nucleus

Product Images

MBD2 Rabbit Polyclonal Antibody

Western blot - MBD2 Rabbit pAb (CAB11982)

Uniprot Information

UniProt Protein Function:MBD2: Binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. Binds hemimethylated DNA as well. Recruits histone deacetylases and DNA methyltransferases. Acts as transcriptional repressor and plays a role in gene silencing. May enhance the activation of some unmethylated cAMP-responsive promoters. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Chromosomal Location of Human Ortholog: 18q21

Cellular Component: nucleoplasm; heterochromatin; protein complex; cytoplasm; nuclear chromatin; histone deacetylase complex; nucleus

Molecular Function:mRNA binding; protein domain specific binding; protein binding; nucleosomal DNA binding; siRNA binding; methyl-CpG binding; satellite DNA binding

Biological Process: cellular protein complex assembly; transcription, DNA-dependent; maternal behavior; negative regulation of gene expression, epigenetic; ATP-dependent chromatin remodeling; gene expression; negative regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; positive regulation of Wnt receptor signaling pathway; regulation of gene expression, epigenetic; regulation of cell proliferation

NCBI Summary:DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. The protein encoded by this gene may function as a mediator of the biological consequences of the methylation signal. It is also reported that the this protein functions as a demethylase to activate transcription, as DNA methylation causes gene silencing. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]
UniProt Code:Q9UBB5
NCBI GenInfo Identifier:50401198
NCBI Gene ID:8932
NCBI Accession:Q9UBB5.1
UniProt Related Accession:Q9UBB5
Molecular Weight:56kDa; 62kDa
NCBI Full Name:Methyl-CpG-binding domain protein 2
NCBI Synonym Full Names:methyl-CpG binding domain protein 2
NCBI Official Symbol:MBD2 
NCBI Official Synonym Symbols:DMTase; NY-CO-41 
NCBI Protein Information:methyl-CpG-binding domain protein 2
UniProt Protein Name:Methyl-CpG-binding domain protein 2
UniProt Synonym Protein Names:Demethylase; DMTase; Methyl-CpG-binding protein MBD2
Protein Family:Methyl-CpG-binding domain protein
UniProt Gene Name:MBD2 
UniProt Entry Name:MBD2_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose