PRKAG3 Rabbit Polyclonal Antibody (CAB7470)

(No reviews yet) Write a Review
SKU:
CAB7470
€99 - €249

Description

Technical Manual

PRKAG3 Rabbit Polyclonal Antibody

Product Name:PRKAG3 Rabbit Polyclonal Antibody
Product SKU:CAB7470
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit is one of the gamma regulatory subunits of AMPK. It is dominantly expressed in skeletal muscle. Studies of the pig counterpart suggest that this subunit may play a key role in the regulation of energy metabolism in skeletal muscle.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human PRKAG3 (NP_059127.2).
Sequence:

MEPGLEHALRRTPSWSSLGGSEHQEMSFLEQENSSSWPSPAVTSSSERIRGKRRAKALRWTRQKSVEEGEPPGQGEGPRSRPAAESTGLEATFPKTTPLAQADPAGVGTPPTGWDCLPSDCTASAAGSSTDDVELATEFPATEAWECELEGLLEERPALCLSPQAPFPKLGWDDELRKPGAQIYMRFMQEHTCYDAMATSSKLVIFDTML

Gene ID:53632
Swiss Prot:Q9UGI9
Synonyms:PRKAG3; AMPKG3
Calculated MW:51kDa/54kDa
Observed MW:
Reactivity:Human
Application:IHC IF
Recommended Dilution:IHC 1:50 - 1:200 IF 1:50 - 1:100
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Immunohistochemistry Immunofluorescence 
Positive Samples:
Cellular Location:

Product Images

PRKAG3 Rabbit Polyclonal Antibody (CAB7470)

Immunohistochemistry of paraffin-embedded human kidney using PRKAG3 antibody (CAB7470) at dilution of 1:100 (40x lens).

Uniprot Information

UniProt Protein Function:AMPKG3: AMP/ATP-binding subunit of AMP-activated protein kinase (AMPK), an energy sensor protein kinase that plays a key role in regulating cellular energy metabolism. In response to reduction of intracellular ATP levels, AMPK activates energy-producing pathways and inhibits energy-consuming processes: inhibits protein, carbohydrate and lipid biosynthesis, as well as cell growth and proliferation. AMPK acts via direct phosphorylation of metabolic enzymes, and by longer-term effects via phosphorylation of transcription regulators. Also acts as a regulator of cellular polarity by remodeling the actin cytoskeleton; probably by indirectly activating myosin. Gamma non-catalytic subunit mediates binding to AMP, ADP and ATP, leading to activate or inhibit AMPK: AMP-binding results in allosteric activation of alpha catalytic subunit (PRKAA1 or PRKAA2) both by inducing phosphorylation and preventing dephosphorylation of catalytic subunits. ADP also stimulates phosphorylation, without stimulating already phosphorylated catalytic subunit. ATP promotes dephosphorylation of catalytic subunit, rendering the AMPK enzyme inactive. AMPK is a heterotrimer of an alpha catalytic subunit (PRKAA1 or PRKAA2), a beta (PRKAB1 or PRKAB2) and a gamma non- catalytic subunits (PRKAG1, PRKAG2 or PRKAG3). Interacts with FNIP1 and FNIP2. Skeletal muscle, with weak expression in heart and pancreas. Belongs to the 5'-AMP-activated protein kinase gamma subunit family. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: cytosol; extracellular space; nucleoplasm

Molecular Function:protein kinase binding

Biological Process: cell cycle arrest; macroautophagy

NCBI Summary:The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits. AMPK is an important energy-sensing enzyme that monitors cellular energy status. In response to cellular metabolic stresses, AMPK is activated, and thus phosphorylates and inactivates acetyl-CoA carboxylase (ACC) and beta-hydroxy beta-methylglutaryl-CoA reductase (HMGCR), key enzymes involved in regulating de novo biosynthesis of fatty acid and cholesterol. This subunit is one of the gamma regulatory subunits of AMPK. It is dominantly expressed in skeletal muscle. Studies of the pig counterpart suggest that this subunit may play a key role in the regulation of energy metabolism in skeletal muscle. [provided by RefSeq, Jul 2008]
UniProt Code:Q9UGI9
NCBI GenInfo Identifier:85681287
NCBI Gene ID:53632
NCBI Accession:Q9UGI9.3
UniProt Secondary Accession:Q9UGI9,Q4QQG8, Q4V779, Q9NRL1,
UniProt Related Accession:Q9UGI9
Molecular Weight:51,484 Da
NCBI Full Name:5'-AMP-activated protein kinase subunit gamma-3
NCBI Synonym Full Names:protein kinase AMP-activated non-catalytic subunit gamma 3
NCBI Official Symbol:PRKAG3 
NCBI Official Synonym Symbols:AMPKG3 
NCBI Protein Information:5'-AMP-activated protein kinase subunit gamma-3
UniProt Protein Name:5'-AMP-activated protein kinase subunit gamma-3
Protein Family:5'-AMP-activated protein kinase
UniProt Gene Name:PRKAG3 
UniProt Entry Name:AAKG3_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose