Anti-Mouse anti GFP-Tag Monoclonal Antibody (CABE072)

SKU:
CABE072
€179

Description

Technical Manual

Anti-Mouse anti GFP-Tag Monoclonal Antibody

Product Name:Anti-Mouse anti GFP-Tag Monoclonal Antibody
Product SKU:CABE072
Size:100 uL
Host Species:Mouse
Purification Method:Affinity purification
Isotype:IgG
Background:

The green fluorescent protein (GFP) is a protein composed of 238 amino acid residues (26.9 kDa) that exhibits bright green fluorescence when exposed to light in the blue to ultraviolet range. Although many other marine organisms have similar green fluorescent proteins, GFP traditionally refers to the protein first isolated from the jellyfish Aequorea victoria. The GFP from A. victoria has a major excitation peak at a wavelength of 395 nm and a minor one at 475 nm. Its emission peak is at 509 nm, which is in the lower green portion of the visible spectrum. The fluorescence quantum yield (QY) of GFP is 0.79. The GFP from the sea pansy (Renilla reniformis) has a single major excitation peak at 498 nm. GFP makes for an excellent tool in many forms of biology due to its ability to form internal chromophore without requiring any accessory cofactors, gene products, or enzymes / substrates other than molecular oxygen. In cell and molecular biology, the GFP gene is frequently used as a reporter of expression. It has been used in modified forms to make biosensors, and many animals have been created that express GFP, which demonstrates a proof of concept that a gene can be expressed throughout a given organism, in selected organs, or in cells of interest. GFP can be introduced into animals or other species through transgenic techniques, and maintained in their genome and that of their offspring. To date, GFP has been expressed in many species, including bacteria, yeasts, fungi, fish and mammals, including in human cells. Scientists Roger Y. Tsien, Osamu Shimomura, and Martin Chalfie were awarded the 2008 Nobel Prize in Chemistry on 10 October 2008 for their discovery and development of the green fluorescent protein.

Immunogen:A synthetic peptide corresponding to a sequence within amino acids 1-100 to the N-terminus of GFP protein.
Sequence:

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK

Gene ID:
Swiss Prot:
Synonyms:GFP; GFP tag; GFP-tag
Calculated MW:27kDa
Observed MW:50KDa
Reactivity:
Application:WB
Recommended Dilution:WB 1:2000 - 1:5000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:293T
Cellular Location:

Product Images

Anti-Mouse anti GFP-Tag Monoclonal Antibody (CABE072)

Western blot - Mouse anti GFP-Tag mAb (CABE072)
View AllClose

Additional Information

Product type:
Antibody
Host Species:
Mouse
Isotype:
IgG
Antibody Type:
Monoclonal Antibody
View AllClose