Anti-SPG11 Antibody (CAB10326)

SKU:
CAB10326
€99 - €249

Description

Technical Manual

Anti-SPG11 Antibody

Product Name:Anti-SPG11 Antibody
Product SKU:CAB10326
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

The protein encoded by this gene is a potential transmembrane protein that is phosphorylated upon DNA damage. Defects in this gene are a cause of spastic paraplegia type 11 (SPG11). Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 550-750 of human SPG11 (NP_079413.3).
Sequence:

KSKENLFNPSSKSSVSDQFDHLSSHLYLRNVEELIPALDLLCSAIRESYSEPQSKHFSEQLLNLTLSFLNNQIKELFIHTEELDEHLQKGVNILTSYINELRTFMIKFPWKLTDAIDEYDVHENVPKVKESNIWKKLSFEEVIASAILNNKIPEAQTFFRIDSHSAQKLEELIGIGLNLVFDNLKKNNIKEASELLKNMGF

Gene ID:80208
Swiss Prot:Q96JI7
Synonyms:SPG11; ALS5; CMT2X; KIAA1840; spatacsin
Calculated MW:236kDa/266kDa/278kDa
Observed MW:280kDa
Reactivity:Human
Application:WB
Recommended Dilution:WB 1:200 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting
Positive Samples:U-87MG
Cellular Location:Cytoplasm, Membrane, Multi-pass membrane protein, Nucleus, cytosol

Product Images

Anti-SPG11 Antibody (CAB10326)

Western blot analysis of extracts of U-87MG cells, using SPG11 antibody (CAB10326) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 90s.

Uniprot Information

UniProt Protein Function:SPG11: Defects in SPG11 are the cause of spastic paraplegia autosomal recessive type 11 (SPG11). Spastic paraplegia is a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 15q21.1

Cellular Component: cytoplasm; cytoplasmic vesicle; cytosol; lysosomal membrane; nucleolus; plasma membrane; synapse

Molecular Function:protein binding

Biological Process: axon cargo transport; synaptic transmission; synaptic vesicle transport

Disease: Amyotrophic Lateral Sclerosis 5, Juvenile; Charcot-marie-tooth Disease, Axonal, Type 2x; Spastic Paraplegia 11, Autosomal Recessive

NCBI Summary:The protein encoded by this gene is a potential transmembrane protein that is phosphorylated upon DNA damage. Defects in this gene are a cause of spastic paraplegia type 11 (SPG11). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2009]
UniProt Code:Q96JI7
NCBI GenInfo Identifier:296452946
NCBI Gene ID:80208
NCBI Accession:Q96JI7.3
UniProt Secondary Accession:Q96JI7,Q4VC11, Q58G86, Q69YG6, Q6NW01, Q8N270, Q8TBU9 Q9H734, A8KAX9, B9EK60, F5H3N6,
UniProt Related Accession:Q96JI7
Molecular Weight:279kDa
NCBI Full Name:Spatacsin
NCBI Synonym Full Names:SPG11, spatacsin vesicle trafficking associated
NCBI Official Symbol:SPG11
NCBI Official Synonym Symbols:ALS5; CMT2X; KIAA1840
NCBI Protein Information:spatacsin
UniProt Protein Name:Spatacsin
UniProt Synonym Protein Names:Colorectal carcinoma-associated protein; Spastic paraplegia 11 protein
Protein Family:Spatacsin
UniProt Gene Name:SPG11
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose