CDK5R1 Rabbit Polyclonal Antibody (CAB17036)

(No reviews yet) Write a Review
SKU:
CAB17036
¥13,151.73 - ¥33,078.60

Description

Technical Manual

CDK5R1 Rabbit Polyclonal Antibody

Product Name:CDK5R1 Rabbit Polyclonal Antibody
Product SKU:CAB17036
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 99-307 of human CDK5R1 (NP_003876.1).
Sequence:

AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR

Gene ID:8851
Swiss Prot:Q15078
Synonyms:CDK5R1; CDK5P35; CDK5R; NCK5A; p23; p25; p35; p35nck5a
Calculated MW:34kDa
Observed MW:Refer to figures
Reactivity:Mouse, Rat
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:
Cellular Location:

Uniprot Information

UniProt Protein Function:CDK5R1: activator of cyclin-dependent kinase 5 (CDK5). Required for proper development of the central nervous system. The p35 form of this protein is cleaved by calpain, generating a p25 form, resulting in the prolonged activation and relocalization of the CDK5 from the cell periphery to nuclear and perinuclear regions. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease, leading to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease.
UniProt Protein Details:

Protein type:Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 17q11.2

Cellular Component: cyclin-dependent protein kinase 5 activator complex; contractile fiber; intracellular membrane-bound organelle; dendrite; postsynaptic density; dendritic spine; cytosol; nucleoplasm; growth cone; membrane; cell soma; perinuclear region of cytoplasm; axon; cytoplasm; plasma membrane; nucleus; neuromuscular junction

Molecular Function:protein serine/threonine kinase activator activity; protein binding; ephrin receptor binding; cadherin binding; cyclin-dependent protein kinase activity; cyclin-dependent protein kinase 5 activator activity; kinase activity; calcium ion binding; protein kinase binding; protein kinase activity

Biological Process: superior olivary nucleus maturation; axon guidance; acetylcholine receptor signaling, muscarinic pathway; regulation of neuron differentiation; hippocampus development; axonal fasciculation; peptidyl-threonine phosphorylation; rhythmic process; neuron migration; negative regulation of axon extension; neuron differentiation; cell proliferation; embryonic development; peptidyl-serine phosphorylation; ionotropic glutamate receptor signaling pathway; positive regulation of neuron apoptosis; regulation of actin cytoskeleton organization and biogenesis; ephrin receptor signaling pathway; cerebellum development; neuron adhesion; brain development; regulation of cyclin-dependent protein kinase activity; negative regulation of transcription, DNA-dependent; neurite development; layer formation in the cerebral cortex; serine phosphorylation of STAT3 protein

NCBI Summary:The protein encoded by this gene (p35) is a neuron-specific activator of cyclin-dependent kinase 5 (CDK5); the activation of CDK5 is required for proper development of the central nervous system. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form. The cleavage of p35 into p25 results in relocalization of the protein from the cell periphery to nuclear and perinuclear regions. P25 deregulates CDK5 activity by prolonging its activation and changing its cellular location. The p25 form accumulates in the brain neurons of patients with Alzheimer's disease. This accumulation correlates with an increase in CDK5 kinase activity, and may lead to aberrantly phosphorylated forms of the microtubule-associated protein tau, which contributes to Alzheimer's disease. [provided by RefSeq, Jul 2008]
UniProt Code:Q15078
NCBI GenInfo Identifier:2498217
NCBI Gene ID:8851
NCBI Accession:Q15078.1
UniProt Secondary Accession:Q15078,Q5U0G3, E1P664,
UniProt Related Accession:Q15078
Molecular Weight:307
NCBI Full Name:Cyclin-dependent kinase 5 activator 1
NCBI Synonym Full Names:cyclin-dependent kinase 5, regulatory subunit 1 (p35)
NCBI Official Symbol:CDK5R1 
NCBI Official Synonym Symbols:p23; p25; p35; CDK5R; NCK5A; CDK5P35; p35nck5a 
NCBI Protein Information:cyclin-dependent kinase 5 activator 1; CDK5 activator 1; neuronal CDK5 activator; TPKII regulatory subunit; regulatory partner for CDK5 kinase; tau protein kinase II 23kDa subunit; cyclin-dependent kinase 5 regulatory subunit 1
UniProt Protein Name:Cyclin-dependent kinase 5 activator 1
UniProt Synonym Protein Names:Cyclin-dependent kinase 5 regulatory subunit 1; TPKII regulatory subunitCleaved into the following 2 chains:Cyclin-dependent kinase 5 activator 1, p35; p35; Cyclin-dependent kinase 5 activator 1, p25; p25Alternative name(s):Tau protein kinase II 23 kDa subunit; p23
Protein Family:Cyclin-dependent kinase 5 activator
UniProt Gene Name:CDK5R1 
UniProt Entry Name:CD5R1_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose