GATA2 Rabbit Polyclonal Antibody (CAB0677)
- SKU:
- CAB0677
Description
GATA2 Rabbit Polyclonal Antibody
| Product Name: | GATA2 Rabbit Polyclonal Antibody |
| Product SKU: | CAB0677 |
| Size: | 20uL, 50 uL |
| Host Species: | Rabbit |
| Purification Method: | Affinity purification |
| Isotype: | IgG |
| Background: | This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants. |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GATA2 (NP_116027.2). |
| Sequence: | MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA |
| Gene ID: | 2624 |
| Swiss Prot: | P23769 |
| Synonyms: | GATA2; DCML; IMD21; MONOMAC; NFE1B |
| Calculated MW: | 49kDa/50kDa |
| Observed MW: | 50kDa |
| Reactivity: | Human, Mouse, Rat |
| Application: | WB IHC |
| Recommended Dilution: | WB 1:500 - 1:2000 IHC 1:50 - 1:200 |
| Storage Buffer: | Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Application Key: | Western blotting Immunohistochemistry |
| Positive Samples: | SW480, BT-474, HeLa, Mouse lung, Mouse kidney, Mouse testis, Rat lung, Rat large intestine |
| Cellular Location: | Nucleus |
Product Images
| Western blot analysis of extracts of various cell lines, using GATA2 antibody (CAB0677) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
| Immunohistochemistry of paraffin-embedded mouse brain using GATA2 antibody (CAB0677) at dilution of 1:100 (40x lens). |
| Immunohistochemistry of paraffin-embedded rat brain using GATA2 antibody (CAB0677) at dilution of 1:100 (40x lens). |
Uniprot Information
| UniProt Protein Function: | GATA2: Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'. Endothelial cells. 2 isoforms of the human protein are produced by alternative splicing. |
| UniProt Protein Details: | Protein type:Transcription factor Chromosomal Location of Human Ortholog: 3q21.3 Cellular Component: nucleoplasm; protein complex Molecular Function:protein binding; zinc ion binding; chromatin binding; transcription factor activity; transcription factor binding Biological Process: inner ear morphogenesis; embryonic placenta development; transcription, DNA-dependent; somatic stem cell maintenance; positive regulation of erythrocyte differentiation; cell maturation; regulation of histone acetylation; negative regulation of transcription from RNA polymerase II promoter; cell fate determination; negative regulation of fat cell differentiation; phagocytosis; cell differentiation in hindbrain; positive regulation of angiogenesis; negative regulation of macrophage differentiation; homeostasis of number of cells within a tissue; commitment of a neuronal cell to a specific type of neuron in the forebrain; pituitary gland development; ventral spinal cord interneuron differentiation; positive regulation of phagocytosis; negative regulation of Notch signaling pathway; positive regulation of megakaryocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; blood coagulation; urogenital system development; central nervous system neuron development Disease: Lymphedema, Primary, With Myelodysplasia; Immunodeficiency 21; Myelodysplastic Syndrome |
| NCBI Summary: | This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009] |
| UniProt Code: | P23769 |
| NCBI GenInfo Identifier: | 229462971 |
| NCBI Gene ID: | 2624 |
| NCBI Accession: | P23769.3 |
| UniProt Secondary Accession: | P23769,Q53YE0, Q96BH0, Q96BH8, Q9BUJ6, D3DNB3, |
| UniProt Related Accession: | P23769 |
| Molecular Weight: | 480 |
| NCBI Full Name: | Endothelial transcription factor GATA-2 |
| NCBI Synonym Full Names: | GATA binding protein 2 |
| NCBI Official Symbol: | GATA2 |
| NCBI Official Synonym Symbols: | DCML; IMD21; NFE1B; MONOMAC |
| NCBI Protein Information: | endothelial transcription factor GATA-2 |
| UniProt Protein Name: | Endothelial transcription factor GATA-2 |
| UniProt Synonym Protein Names: | GATA-binding protein 2 |
| Protein Family: | GATA-binding factor |
| UniProt Gene Name: | GATA2 |
| UniProt Entry Name: | GATA2_HUMAN |
Additional Information
Product type: |
Antibody |
Reactivity: |
Human |
Reactivity: |
Mouse |
Reactivity: |
Rat |
Host Species: |
Rabbit |
Isotype: |
IgG |
Antibody Type: |
Polyclonal Antibody |
Related Products
EIN3 Rabbit Polyclonal Antibody
FBXO24 Rabbit Polyclonal Antibody
TRIM31 Rabbit Polyclonal Antibody
SPC25 Rabbit Polyclonal Antibody
