GATA2 Rabbit Polyclonal Antibody (CAB0677)

(No reviews yet) Write a Review
SKU:
CAB0677
  • Western blot analysis of extracts of various cell lines, using GATA2 antibody (CAB0677) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.
  • Immunohistochemistry of paraffin-embedded mouse brain using GATA2 antibody (CAB0677) at dilution of 1:100 (40x lens).
  • Immunohistochemistry of paraffin-embedded rat brain using GATA2 antibody (CAB0677) at dilution of 1:100 (40x lens).
€99 - €249

Description

Technical Manual

GATA2 Rabbit Polyclonal Antibody

Product Name:GATA2 Rabbit Polyclonal Antibody
Product SKU:CAB0677
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human GATA2 (NP_116027.2).
Sequence:

MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYYANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSPFSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKEVSPDPSTTGAASPASSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQPATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA

Gene ID:2624
Swiss Prot:P23769
Synonyms:GATA2; DCML; IMD21; MONOMAC; NFE1B
Calculated MW:49kDa/50kDa
Observed MW:50kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry 
Positive Samples:SW480, BT-474, HeLa, Mouse lung, Mouse kidney, Mouse testis, Rat lung, Rat large intestine
Cellular Location:Nucleus

Product Images

GATA2 Rabbit Polyclonal Antibody (CAB0677)

Western blot analysis of extracts of various cell lines, using GATA2 antibody (CAB0677) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.

GATA2 Rabbit Polyclonal Antibody (CAB0677)

Immunohistochemistry of paraffin-embedded mouse brain using GATA2 antibody (CAB0677) at dilution of 1:100 (40x lens).

GATA2 Rabbit Polyclonal Antibody (CAB0677)

Immunohistochemistry of paraffin-embedded rat brain using GATA2 antibody (CAB0677) at dilution of 1:100 (40x lens).

Uniprot Information

UniProt Protein Function:GATA2: Transcriptional activator which regulates endothelin-1 gene expression in endothelial cells. Binds to the consensus sequence 5'-AGATAG-3'. Endothelial cells. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Transcription factor

Chromosomal Location of Human Ortholog: 3q21.3

Cellular Component: nucleoplasm; protein complex

Molecular Function:protein binding; zinc ion binding; chromatin binding; transcription factor activity; transcription factor binding

Biological Process: inner ear morphogenesis; embryonic placenta development; transcription, DNA-dependent; somatic stem cell maintenance; positive regulation of erythrocyte differentiation; cell maturation; regulation of histone acetylation; negative regulation of transcription from RNA polymerase II promoter; cell fate determination; negative regulation of fat cell differentiation; phagocytosis; cell differentiation in hindbrain; positive regulation of angiogenesis; negative regulation of macrophage differentiation; homeostasis of number of cells within a tissue; commitment of a neuronal cell to a specific type of neuron in the forebrain; pituitary gland development; ventral spinal cord interneuron differentiation; positive regulation of phagocytosis; negative regulation of Notch signaling pathway; positive regulation of megakaryocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; blood coagulation; urogenital system development; central nervous system neuron development

Disease: Lymphedema, Primary, With Myelodysplasia; Immunodeficiency 21; Myelodysplastic Syndrome

NCBI Summary:This gene encodes a member of the GATA family of zinc-finger transcription factors that are named for the consensus nucleotide sequence they bind in the promoter regions of target genes. The encoded protein plays an essential role in regulating transcription of genes involved in the development and proliferation of hematopoietic and endocrine cell lineages. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Mar 2009]
UniProt Code:P23769
NCBI GenInfo Identifier:229462971
NCBI Gene ID:2624
NCBI Accession:P23769.3
UniProt Secondary Accession:P23769,Q53YE0, Q96BH0, Q96BH8, Q9BUJ6, D3DNB3,
UniProt Related Accession:P23769
Molecular Weight:480
NCBI Full Name:Endothelial transcription factor GATA-2
NCBI Synonym Full Names:GATA binding protein 2
NCBI Official Symbol:GATA2 
NCBI Official Synonym Symbols:DCML; IMD21; NFE1B; MONOMAC 
NCBI Protein Information:endothelial transcription factor GATA-2
UniProt Protein Name:Endothelial transcription factor GATA-2
UniProt Synonym Protein Names:GATA-binding protein 2
Protein Family:GATA-binding factor
UniProt Gene Name:GATA2 
UniProt Entry Name:GATA2_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose