Hepatitis B Virus e-Antigen Recombinant Protein (CPRT5509)

(No reviews yet) Write a Review
SKU:
CPRT5509
€278

Description

Data SheetMSDS

HBeAg Recombinant Protein

Name:HBeAg
Synonyms:N/A
Introduction:Hepatitis B virus is the main cause for human liver disease, chronic infection frequently causes liver cancer and cirrhosis. The HBV core gene codes 2 distinct protein products, a 21.5–kDa protein beingassembled to form nucleocapsid particles designated HBcAg, which wraps the viral DNA as well as the viral polymerase and RNase H, and a precore protein, designated as HBeAg, which is directly to the endoplasmic reticulum, processed at N– and C–terminally and secreted as non–particulate e–anitgen (HBeAg). The pre–core protein contains an extra 29 N–terminal amino acids, servingas a signal peptide to direct the nascent polypeptide into secretory pathway. After the secretion, mature HBeAgis deleted at the residue 149 C–terminally and retains 10 precore residues N–terminally. HBcAgand HBeAgare distinctly recognized by antibodies but highly cross–reactive at the T–cell level.The e antigen is found in the circulation, it is found duringthe active HBV infection, positive result indicates the risk for contagiousness, and is also used as indicator for the effectiveness of HBV treatment. Positive anti–HBeAgspecifies an active stage of acute HBV infection that is in its final stages, the risk for contagiousness is dramatically reduced.
Description:Recombinant hepatitis B virus “e” antigen produced in E.coli, is a 149a.a protein and having a molecular mass of approximately 18kDa. The HBeAgsequence is derived from HBV adw2 and fused to 6xHis tag at C–terminus.
Source:Escherichia Coli.
Pack size:25µg
Physical Appearance:N/A
Formulation:Phosphate buffered saline with 50mM arginine.
Solubility:N/A
Stability:HBeAgalthough stable at 4°C for 1 week, should be stored below –18°C. Please prevent freeze thaw cycles.
Purity:Protein is >95% pure as determined by 12% PAGE (coomassie staining).
Amino Acid Sequence:MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVGNNL EDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVV
Biological Activity:N/A
Usage:Assay Genie’s products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
View AllClose

Additional Information

Product type:
Recombinant Protein
Reactivity:
Hepatitis B
Host Species:
E.Coli
View AllClose

0 Reviews

View AllClose